Property Summary

NCBI Gene PubMed Count 11
Grant Count 11
R01 Count 5
Funding $2,684,272.53
PubMed Score 11.94
PubTator Score 25.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.169 0.001
astrocytic glioma -1.200 0.031
psoriasis -1.600 0.002
pancreatic ductal adenocarcinoma liver m... -2.051 0.023
intraductal papillary-mucinous neoplasm ... 1.600 0.003
lung cancer 1.500 0.000
Parkinson's disease -1.100 0.019
Pick disease -1.200 0.000
ovarian cancer 1.600 0.011

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MFACAKLACTPSLIRAGSRVAYRPISASVLSRPEASRTGEGSTVFNGAQNGVSQLIQREFQTSAISRDID      1 - 70
TAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF     71 - 140
AM                                                                        141 - 142
//

Text Mined References (12)

PMID Year Title
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14749816 2004 Molecular motors: turning the ATP motor.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9834036 1998 Energy transduction in the F1 motor of ATP synthase.
9461222 1998 Energy transduction in ATP synthase.
8328972 1993 Sequences of members of the human gene family for the c subunit of mitochondrial ATP synthase.
More...