Property Summary

NCBI Gene PubMed Count 66
Grant Count 123
R01 Count 73
Funding $28,109,632.14
PubMed Score 195.77
PubTator Score 127.18

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P48200 A8KAC7 E1CJT9 H0YKU0 Q13095 Q1HE21 Q59FQ7 Q8WVK6 Q9UF17 IRE-BP 2
Symbols ACO3
IRP2
IRP2AD

Gene

PANTHER Protein Class (2)

Gene RIF (42)

PMID Text
26775557 The current results revealed that there was significant association between IREB2 gene rs2568494 polymorphism with susceptibility to Chronic Obstructive Pulmonary Disease.
26752519 Irp2 expression is increased in airway epithelial cells exposed to cigarette smoke.
26527870 IREB2 - candidate gene for Chronic Obstructive Pulmonary Disease identified by Genome-wide association studies.
26310313 This study confirms that the IREB2 variants contribute to an increased risk of lung cancer, whereas FAM13A predisposes to increased susceptibility to chronic obstructive pulmonary disease.
25117307 IRP2 can regulate the expression of TfR and Fn by changing its own protein expression and thereby regulate iron metabolism.
25101718 Genetic variants near IREB2 and GALC likely contribute to genetic susceptibility to PAE associated with COPD.
25006744 IRE2 is located within genes previously associated with chronic obstructive pulmonary disease susceptibility.
24587150 Haplotypes of IREB2 carrying major alleles of rs2568494 (G), rs2656069 (A), rs10851906 (A), rs965604 (C) and minor alleles of rs1964678 (T), rs12593229 (T) showed negative correlation with lung function amongst South Indian male smokers with COPD.
24394537 Ascorbate-induced up-regulation of cellular ferroportin levels was associated with increased levels of the iron regulatory protein IRP2, and the hypoxia-inducible factor HIF2alpha.
24285726 dysregulation of IRP2 is an early nodal point underlying altered iron metabolism in breast cancer and may contribute to poor outcome of some patients with breast cancer
More...

AA Sequence

MDAPKAGYAFEYLIETLNDSSHKKFFDVSKLGTKYDVLPYSIRVLLEAAVRNCDGFLMKKEDVMNILDWK      1 - 70
TKQSNVEVPFFPARVLLQDFTGIPAMVDFAAMREAVKTLGGDPEKVHPACPTDLTVDHSLQIDFSKCAIQ     71 - 140
NAPNPGGGDLQKAGKLSPVKVQPKKLPCRGQTTCRGSCDSGELGRNSGTFSSQIENTPILCPFHLQPVPE    141 - 210
PETVLKNQEVEFGRNRERLQFFKWSSRVFKNVAVIPPGTGMAHQINLEYLSRVVFEEKDLLFPDSVVGTD    211 - 280
SHITMVNGLGILGWGVGGIETEAVMLGLPVSLTLPEVVGCELTGSSNPFVTSIDVVLGITKHLRQVGVAG    281 - 350
KFVEFFGSGVSQLSIVDRTTIANMCPEYGAILSFFPVDNVTLKHLEHTGFSKAKLESMETYLKAVKLFRN    351 - 420
DQNSSGEPEYSQVIQINLNSIVPSVSGPKRPQDRVAVTDMKSDFQACLNEKVGFKGFQIAAEKQKDIVSI    421 - 490
HYEGSEYKLSHGSVVIAAVISCTNNCNPSVMLAAGLLAKKAVEAGLRVKPYIRTSLSPGSGMVTHYLSSS    491 - 560
GVLPYLSKLGFEIVGYGCSICVGNTAPLSDAVLNAVKQGDLVTCGILSGNKNFEGRLCDCVRANYLASPP    561 - 630
LVVAYAIAGTVNIDFQTEPLGTDPTGKNIYLHDIWPSREEVHRVEEEHVILSMFKALKDKIEMGNKRWNS    631 - 700
LEAPDSVLFPWDLKSTYIRCPSFFDKLTKEPIALQAIENAHVLLYLGDSVTTDHISPAGSIARNSAAAKY    701 - 770
LTNRGLTPREFNSYGARRGNDAVMTRGTFANIKLFNKFIGKPAPKTIHFPSGQTLDVFEAAELYQKEGIP    771 - 840
LIILAGKKYGSGNSRDWAAKGPYLLGVKAVLAESYEKIHKDHLIGIGIAPLQFLPGENADSLGLSGRETF    841 - 910
SLTFPEELSPGITLNIQTSTGKVFSVIASFEDDVEITLYKHGGLLNFVARKFS                     911 - 963
//

Text Mined References (72)

PMID Year Title
26775557 2016 Association of IREB2 Gene rs2568494 Polymorphism with Risk of Chronic Obstructive Pulmonary Disease: A Meta-Analysis.
26752519 2016 Mitochondrial iron chelation ameliorates cigarette smoke-induced bronchitis and emphysema in mice.
26527870 2015 Candidate genes for COPD: current evidence and research.
26310313 2015 Susceptibility loci in lung cancer and COPD: association of IREB2 and FAM13A with pulmonary diseases.
25241909 2014 Genetic susceptibility for chronic bronchitis in chronic obstructive pulmonary disease.
25117307 2014 Regulatory effect of iron regulatory protein-2 on iron metabolism in lung cancer.
25101718 2015 IREB2 and GALC are associated with pulmonary artery enlargement in chronic obstructive pulmonary disease.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
25006744 2014 Genome-wide association identifies regulatory Loci associated with distinct local histogram emphysema patterns.
24587150 2014 Genetic determinants of chronic obstructive pulmonary disease in South Indian male smokers.
More...