Property Summary

Ligand Count 23
NCBI Gene PubMed Count 34
PubMed Score 17.69
PubTator Score 17.57

Knowledge Summary

Patent (1,035)

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.100 1.2e-02
astrocytic glioma -1.900 1.1e-02
Astrocytoma, Pilocytic -1.600 1.8e-05
atypical teratoid / rhabdoid tumor -1.700 1.2e-06
ependymoma -1.100 2.5e-02
glioblastoma -1.500 1.2e-07
group 3 medulloblastoma -2.000 1.3e-03
medulloblastoma, large-cell -1.500 7.6e-04
oligodendroglioma -3.200 9.0e-20
pituitary cancer -1.100 9.2e-05
primitive neuroectodermal tumor -1.600 4.1e-03
psoriasis 1.200 1.4e-03

Gene RIF (26)

AA Sequence

MVSAKKVPAIALSAGVSFALLRFLCLAVCLNESPGQNQKEEKLCTENFTRILDSLLDGYDNRLRPGFGGP      1 - 70
VTEVKTDIYVTSFGPVSDVEMEYTMDVFFRQTWIDKRLKYDGPIEILRLNNMMVTKVWTPDTFFRNGKKS     71 - 140
VSHNMTAPNKLFRIMRNGTILYTMRLTISAECPMRLVDFPMDGHACPLKFGSYAYPKSEMIYTWTKGPEK    141 - 210
SVEVPKESSSLVQYDLIGQTVSSETIKSITGEYIVMTVYFHLRRKMGYFMIQTYIPCIMTVILSQVSFWI    211 - 280
NKESVPARTVFGITTVLTMTTLSISARHSLPKVSYATAMDWFIAVCFAFVFSALIEFAAVNYFTNIQMEK    281 - 350
AKRKTSKPPQEVPAAPVQREKHPEAPLQNTNANLNMRKRTNALVHSESDVGNRTEVGNHSSKSSTVVQES    351 - 420
SKGTPRSYLASSPNPFSRANAAETISAARALPSASPTSIRTGYMPRKASVGSASTRHVFGSRLQRIKTTV    421 - 490
NTIGATGKLSATPPPSAPPPSGSGTSKIDKYARILFPVTFGAFNMVYWVVYLSKDTMEKSESLM          491 - 554
//

Text Mined References (37)

PMID Year Title