Property Summary

NCBI Gene PubMed Count 33
Grant Count 19
R01 Count 6
Funding $1,575,876.23
PubMed Score 90.34
PubTator Score 819.57

Knowledge Summary

Patent

No data available

Expression

Gene RIF (14)

PMID Text
26173780 ME1 expression was found to be mutant-KRAS-associated in NSCLC cancer cell lines. Patients with elevated ME1 had worse outcomes after radiotherapy. Transamination generating cytosolic NADPH via ME1 may contribute to radioresistance.
25753478 ME1 overexpression associates with unfavorable prognoses in patients with HCC, suggesting that ME1 is a poor prognostic predictor of hepatocellular carcinoma.
23334421 p53 represses the expression of the tricarboxylic-acid-cycle-associated malic enzymes ME1 and ME2 in human and mouse cells
23284632 the differential protein stability between dimer and tetramer interface interactions of human c-NADP-ME
23114090 essential role for ME1 in the production of cytosolic NADPH and maintenance of migratory and invasive abilities of nasopharyngeal carcinoma cells
22456781 cytosolic malic enzyme 1 gene polymorphism is associated with the degree of suppression of parathyroid hormone after long-term calcium supplementation; the effect is probably mediated through an increase in intestinal calcium absorption
21555518 ME1 is a functional target gene of the BACH1 transcription factor according to ChIP-seq and knockdown analysis in HEK 293 cells.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19464998 A series of R98/D102 mutants examined the possible interactions between Arg98 and Asp102 using double-mutant cycle analysis. Kinetic analysis revealed that the catalytic efficiency of was severely affected by mutating both Arg98 and Asp102 residues.
19416979 human c-NADP-ME exists mainly as a tetramer, whereas human m-NAD(P)-ME exists as a mixture of dimers and tetramers
More...

AA Sequence

MEPEAPRRRHTHQRGYLLTRNPHLNKDLAFTLEERQQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFD      1 - 70
RYLLLMDLQDRNEKLFYRVLTSDIEKFMPIVYTPTVGLACQQYSLVFRKPRGLFITIHDRGHIASVLNAW     71 - 140
PEDVIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQECLPVILDVGTENEELLKDPLYIG    141 - 210
LRQRRVRGSEYDDFLDEFMEAVSSKYGMNCLIQFEDFANVNAFRLLNKYRNQYCTFNDDIQGTASVAVAG    211 - 280
LLAALRITKNKLSDQTILFQGAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGRASLTQE    281 - 350
KEKFAHEHEEMKNLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQC    351 - 420
YKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGVALGVVACGLRQITDNIFLTTAEVIAQQVS    421 - 490
DKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEAFVRSQMYSTDYDQILPDCYSWP    491 - 560
EEVQKIQTKVDQ                                                              561 - 572
//

Text Mined References (36)

PMID Year Title
26173780 2015 Mutant KRAS associated malic enzyme 1 expression is a predictive marker for radiation therapy response in non-small cell lung cancer.
25753478 2015 Malic enzyme 1 induces epithelial-mesenchymal transition and indicates poor prognosis in hepatocellular carcinoma.
23334421 2013 Reciprocal regulation of p53 and malic enzymes modulates metabolism and senescence.
23284632 2012 Biophysical characterization of the dimer and tetramer interface interactions of the human cytosolic malic enzyme.
23114090 2012 Repressing malic enzyme 1 redirects glucose metabolism, unbalances the redox state, and attenuates migratory and invasive abilities in nasopharyngeal carcinoma cell lines.
22456781 2012 Malic enzyme gene polymorphism is associated with responsiveness in circulating parathyroid hormone after long-term calcium supplementation.
21555518 2011 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19464998 2009 Long-range interaction between the enzyme active site and a distant allosteric site in the human mitochondrial NAD(P)+-dependent malic enzyme.
More...