Property Summary

NCBI Gene PubMed Count 54
Grant Count 1,247
R01 Count 334
Funding $692,851,878.78
PubMed Score 335.17
PubTator Score 470.21

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P48147 Q8N6D4 PE
Symbols PE
PEP

Gene

PANTHER Protein Class (3)

PDB

3DDU  

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
463149 other 3 / 0 / 21 Late stage assay provider results from the probe development effort to identify inhibitors of PME-1: Fluorescence-based biochemical gel-based ABPP inhibition and selectivity
651979 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify selective inhibitors of LYPLA1: LCMS-based cell-based Activity-Based Protein Profiling (ABPP) SILAC selectivity analysis in situ
651980 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify selective inhibitors of LYPLA2: LCMS-based cell-based Activity-Based Protein Profiling (ABPP) SILAC selectivity analysis in situ

Gene RIF (32)

PMID Text
26420028 This study found that circulating PREP activity was substantially reduced in all cirrhotic patients but those changes did not have evident correlation to hepatic encephalopathy.
26222144 TLR4 activation releases prolyl endopeptidase containing exosomes from airway epithelial cells.
26165750 PEP was significantly and positively associated with delinquent, aggressive, externalizing and internalizing behavior subscales.
25236746 PREP redox inactivation is due to oxidation of cysteine residues and consequent oligomerization through intermolecular disulfide bonds.
24931469 Data indicate that SAXS analysis showed that presequence protease (hPreP) open states and substrate binding dynamics.
24465166 The determination of PEP activity in the plasma may be a safe, minimally invasive and inexpensive way to define the aggressiveness of CRC in daily practice.
24269815 These results indicate that POP may be a positive regulator of cell cycle progression by regulating the exit from and/or reentry into the cell cycle by KATO III cells.
23643808 Oxidative stress and the levels of endogenous plasma prolyl oligopeptidase (PREP) inhibitor alpha-2-macroglobulin (alpha2M) decrease PREP activity in multiple sclerosis patients.
23562579 first demonstration of colocalization of PREP and pathological proteins in the human brain, supporting the view that, at least in spatial terms, PREP could be associated with pathogenesis of neurodegenerative diseases
23348613 interaction between prolyl oligopeptidase and glyceraldehyde-3-phosphate dehydrogenase is required for cytosine arabinoside-induced glyceraldehyde-3-phosphate dehydrogenase nuclear translocation and cell death
More...

AA Sequence

MLSLQYPDVYRDETAVQDYHGHKICDPYAWLEDPDSEQTKAFVEAQNKITVPFLEQCPIRGLYKERMTEL      1 - 70
YDYPKYSCHFKKGKRYFYFYNTGLQNQRVLYVQDSLEGEARVFLDPNILSDDGTVALRGYAFSEDGEYFA     71 - 140
YGLSASGSDWVTIKFMKVDGAKELPDVLERVKFSCMAWTHDGKGMFYNSYPQQDGKSDGTETSTNLHQKL    141 - 210
YYHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLQQESSGIAGILKWV    211 - 280
KLIDNFEGEYDYVTNEGTVFTFKTNRQSPNYRVINIDFRDPEESKWKVLVPEHEKDVLEWIACVRSNFLV    281 - 350
LCYLHDVKNILQLHDLTTGALLKTFPLDVGSIVGYSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPR    351 - 420
VFREVTVKGIDASDYQTVQIFYPSKDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLI    421 - 490
FVRHMGGILAVANIRGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLV    491 - 560
AACANQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDSKQHFEWLVKYSPLHNVKLPEADDIQY    561 - 630
PSMLLLTADHDDRVVPLHSLKFIATLQYIVGRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFI    631 - 700
ARCLNVDWIP                                                                701 - 710
//

Text Mined References (60)

PMID Year Title
26420028 2015 The expression levels of prolyl oligopeptidase responds not only to neuroinflammation but also to systemic inflammation upon liver failure in rat models and cirrhotic patients.
26222144 2016 Toll-Like Receptor 4 Engagement Mediates Prolyl Endopeptidase Release from Airway Epithelia via Exosomes.
26165750 2015 Prolyl endopeptidase and dipeptidyl peptidase IV are associated with externalizing and aggressive behaviors in normal and autistic adolescents.
25236746 2014 Mechanism of oxidative inactivation of human presequence protease by hydrogen peroxide.
24931469 2014 Molecular basis of substrate recognition and degradation by human presequence protease.
24465166 2014 Prolyl endopeptidase activity is correlated with colorectal cancer prognosis.
24269815 2014 Prolyl oligopeptidase inhibition-induced growth arrest of human gastric cancer cells.
23643808 2013 Alteration of prolyl oligopeptidase and activated ?-2-macroglobulin in multiple sclerosis subtypes and in the clinically isolated syndrome.
23562579 2013 Prolyl oligopeptidase colocalizes with ?-synuclein, ?-amyloid, tau protein and astroglia in the post-mortem brain samples with Parkinson's and Alzheimer's diseases.
23348613 2013 Prolyl oligopeptidase is a glyceraldehyde-3-phosphate dehydrogenase-binding protein that regulates genotoxic stress-induced cell death.
More...