Property Summary

NCBI Gene PubMed Count 13
PubMed Score 9.08
PubTator Score 7.24

Knowledge Summary

Patent (7,398)

TINX Plot

  Disease (1)

Gene RIF (4)

AA Sequence

MQAAGHPEPLDSRGSFSLPTMGANVSQDNGTGHNATFSEPLPFLYVLLPAVYSGICAVGLTGNTAVILVI      1 - 70
LRAPKMKTVTNVFILNLAVADGLFTLVLPVNIAEHLLQYWPFGELLCKLVLAVDHYNIFSSIYFLAVMSV     71 - 140
DRYLVVLATVRSRHMPWRTYRGAKVASLCVWLGVTVLVLPFFSFAGVYSNELQVPSCGLSFPWPEQVWFK    141 - 210
ASRVYTLVLGFVLPVCTICVLYTDLLRRLRAVRLRSGAKALGKARRKVTVLVLVVLAVCLLCWTPFHLAS    211 - 280
VVALTTDLPQTPLVISMSYVITSLSYANSCLNPFLYAFLDDNFRKNFRSILRC                     281 - 333
//

Text Mined References (15)

PMID Year Title