Property Summary

NCBI Gene PubMed Count 12
Grant Count 1
Funding $220,126
PubMed Score 8.84
PubTator Score 7.24

Knowledge Summary

Patent (7,398)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Cryptorchidism 67 3.522 1.8

Synonym

Accession P48146 Q6NWQ6 Q9H4K3
Symbols GPR8

Gene

PANTHER Protein Class (2)

 Grant Application (1)

  TechDev Info (1)

Gene RIF (3)

PMID Text
15797961 Expressed in the zona glomerulosa and zona fasciculata-reticularis ( cells of the human adrenal cortex.
12719537 characterization of a family of endogenous neuropeptide ligands for this G protein-coupled receptor
12401809 distribution in central nervous system and peripheral tissues with precursor peptides

AA Sequence

MQAAGHPEPLDSRGSFSLPTMGANVSQDNGTGHNATFSEPLPFLYVLLPAVYSGICAVGLTGNTAVILVI      1 - 70
LRAPKMKTVTNVFILNLAVADGLFTLVLPVNIAEHLLQYWPFGELLCKLVLAVDHYNIFSSIYFLAVMSV     71 - 140
DRYLVVLATVRSRHMPWRTYRGAKVASLCVWLGVTVLVLPFFSFAGVYSNELQVPSCGLSFPWPEQVWFK    141 - 210
ASRVYTLVLGFVLPVCTICVLYTDLLRRLRAVRLRSGAKALGKARRKVTVLVLVVLAVCLLCWTPFHLAS    211 - 280
VVALTTDLPQTPLVISMSYVITSLSYANSCLNPFLYAFLDDNFRKNFRSILRC                     281 - 333
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15797961 2005 G protein receptors 7 and 8 are expressed in human adrenocortical cells, and their endogenous ligands neuropeptides B and w enhance cortisol secretion by activating adenylate cyclase- and phospholipase C-dependent signaling cascades.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12719537 2003 Characterization of a family of endogenous neuropeptide ligands for the G protein-coupled receptors GPR7 and GPR8.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12401809 2003 Identification of natural ligands for the orphan G protein-coupled receptors GPR7 and GPR8.
More...