Property Summary

Ligand Count 8
NCBI Gene PubMed Count 15
PubMed Score 19.81
PubTator Score 19.14

Knowledge Summary

Patent (7,512)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Gene RIF (9)

AA Sequence

MDNASFSEPWPANASGPDPALSCSNASTLAPLPAPLAVAVPVVYAVICAVGLAGNSAVLYVLLRAPRMKT      1 - 70
VTNLFILNLAIADELFTLVLPINIADFLLRQWPFGELMCKLIVAIDQYNTFSSLYFLTVMSADRYLVVLA     71 - 140
TAESRRVAGRTYSAARAVSLAVWGIVTLVVLPFAVFARLDDEQGRRQCVLVFPQPEAFWWRASRLYTLVL    141 - 210
GFAIPVSTICVLYTTLLCRLHAMRLDSHAKALERAKKRVTFLVVAILAVCLLCWTPYHLSTVVALTTDLP    211 - 280
QTPLVIAISYFITSLSYANSCLNPFLYAFLDASFRRNLRQLITCRAAA                          281 - 328
//

Text Mined References (17)

PMID Year Title