Property Summary

NCBI Gene PubMed Count 15
Grant Count 7
R01 Count 6
Funding $334,359.35
PubMed Score 19.47
PubTator Score 19.14

Knowledge Summary

Patent (7,512)

Gene RIF (9)

PMID Text
24081945 hypermethylation of HIST1H4F, PCDHGB6, NPBWR1, ALX1, and HOXA9 was significantly associated with shorter survival in stage 1 Non-small-cell lung cancer
23563248 screening of GPR7 gene mutations among lean and obese subjects revealed a Tyr135Phe allelic variant that is fairly common in the study population. This variant is unlikely to cause a functional derangement of the receptor
22545105 A single nucleotide polymorphism of NPBWR1 changed the receptor function of this molecule at the cellular level, and, at the behavioral level, could influence personality difference in the context of social interaction.
17437806 methylation of the GPR7 is significantly associated with prostate cancer prognosis.
15797961 Expressed in the zona glomerulosa and zona fasciculata-reticularis ( cells of the human adrenal cortex.
15607941 These results suggest a relationship between the pathogenesis of inflammatory/immune-mediated neuropathies, GPR7 receptor expression, and pain transmission.
12719537 characterization of a family of endogenous neuropeptide ligands for this G protein-coupled receptor
12401809 distribution in central nervous system and peripheral tissues with precursor peptides
12118011 neuropeptide B, a neuropeptide modified with bromine is an endogenous ligand for GPR7

AA Sequence

MDNASFSEPWPANASGPDPALSCSNASTLAPLPAPLAVAVPVVYAVICAVGLAGNSAVLYVLLRAPRMKT      1 - 70
VTNLFILNLAIADELFTLVLPINIADFLLRQWPFGELMCKLIVAIDQYNTFSSLYFLTVMSADRYLVVLA     71 - 140
TAESRRVAGRTYSAARAVSLAVWGIVTLVVLPFAVFARLDDEQGRRQCVLVFPQPEAFWWRASRLYTLVL    141 - 210
GFAIPVSTICVLYTTLLCRLHAMRLDSHAKALERAKKRVTFLVVAILAVCLLCWTPYHLSTVVALTTDLP    211 - 280
QTPLVIAISYFITSLSYANSCLNPFLYAFLDASFRRNLRQLITCRAAA                          281 - 328
//

Text Mined References (17)

PMID Year Title
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
24081945 2013 A prognostic DNA methylation signature for stage I non-small-cell lung cancer.
23563248 2013 Frequency of the GPR7 Tyr135Phe allelic variant in lean and obese subjects.
22545105 2012 A single nucleotide polymorphism of the neuropeptide B/W receptor-1 gene influences the evaluation of facial expressions.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
17437806 2007 Discovery and validation of 3 novel DNA methylation markers of prostate cancer prognosis.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15797961 2005 G protein receptors 7 and 8 are expressed in human adrenocortical cells, and their endogenous ligands neuropeptides B and w enhance cortisol secretion by activating adenylate cyclase- and phospholipase C-dependent signaling cascades.
15607941 2005 Schwann cell overexpression of the GPR7 receptor in inflammatory and painful neuropathies.
More...