Property Summary

Ligand Count 500
NCBI Gene PubMed Count 32
PubMed Score 10.45
PubTator Score 153.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma 1.300 1.0e-02
cutaneous lupus erythematosus -1.200 2.8e-03
ependymoma 1.500 4.2e-03
glioblastoma 1.700 5.5e-03
mucosa-associated lymphoid tissue lympho... 1.150 3.8e-02
oligodendroglioma 1.300 3.6e-03
pediatric high grade glioma 1.300 5.1e-03
Polycystic ovary syndrome -1.035 1.2e-02
psoriasis -1.200 3.9e-03

Gene RIF (21)

AA Sequence

MSGGDTRAAIARPRMAAAHGPVAPSSPEQVTLLPVQRSFFLPPFSGATPSTSLAESVLKVWHGAYNSGLL      1 - 70
PQLMAQHSLAMAQNGAVPSEATKRDQNLKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMF     71 - 140
PYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFSS    141 - 210
MTHVLPWAYCNNPWNTHDCAGVLDASNLTNGSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKLSDDI    211 - 280
GNFGEVRLPLLGCLGVSWLVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFDGIMYYLTP    281 - 350
QWDKILEAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGF    351 - 420
MANHLGVDVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEVGN    421 - 490
EWILQKKTYVTLGVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVISCIMCVAIMYIYGHRNYFQDI    491 - 560
QMMLGFPPPLFFQICWRFVSPAIIFFILVFTVIQYQPITYNHYQYPGWAVAIGFLMALSSVLCIPLYAMF    561 - 630
RLCRTDGDTLLQRLKNATKPSRDWGPALLEHRTGRYAPTIAPSPEDGFEVQPLHPDKAQIPIVGSNGSSR    631 - 700
LQDSRI                                                                    701 - 706
//

Text Mined References (33)

PMID Year Title