Property Summary

NCBI Gene PubMed Count 29
PubMed Score 9.43
PubTator Score 153.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma 1.300 0.010
ependymoma 1.500 0.004
oligodendroglioma 1.300 0.004
cutaneous lupus erythematosus -1.200 0.003
psoriasis -1.200 0.004
glioblastoma 1.700 0.006
pediatric high grade glioma 1.300 0.005
Polycystic Ovary Syndrome -1.035 0.012
mucosa-associated lymphoid tissue lympho... 1.150 0.038

Synonym

Accession P48067 A6NDH1 A6NII2 A6NNZ8 Q5TAB8 Q5TAB9 Q5TAC0 GlyT-1
Symbols GLYT1

Gene

PANTHER Protein Class (2)

Gene RIF (19)

PMID Text
26302655 Study found that temporal lobe epilepsy is associated with increased levels of GlyT1
23132267 Following biopterin administration, glycine transporter type I occupancy correlates with biopterin plasma concentration.
22705056 The increased sensitivity of human GlyT1c to sanguinarine is abolished by the mutation of only cysteine 475.
22425803 Synaptic and extrasynaptic concentrations of glycine are regulated by its type-1 glycine transporter, which is primarily expressed in astroglial and glutamatergic cell membranes.
21688322 Human positron-emission tomography studies determine the test-retest reproducibility of [11C]GSK931145, a ligand which readily enters the brain, displaying a heterogeneous uptake which corresponds well with the known distribution of GlyT-1.
21628872 metabolic functions of GLYT1 in intestine: metabolism/regulation of glycine/glutathione; role in response to physiological stress (e.g., oxidative stress); possible role in pathophysiology/therapy of inflammatory bowel diseases [REVIEW]
19650813 Observational study of gene-disease association. (HuGE Navigator)
19556729 association between SLC6A9 SNPs and essential hypertension in a Japanese population, suggesting that SLC6A9 is a susceptibility locus for essential hypertension.
19556729 Observational study of gene-disease association. (HuGE Navigator)
19427831 the results suggest that GLYT1 and membrane rafts are co-localized in the membrane, and that this influences the rate of glycine transport.
More...

AA Sequence

MSGGDTRAAIARPRMAAAHGPVAPSSPEQVTLLPVQRSFFLPPFSGATPSTSLAESVLKVWHGAYNSGLL      1 - 70
PQLMAQHSLAMAQNGAVPSEATKRDQNLKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMF     71 - 140
PYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFSS    141 - 210
MTHVLPWAYCNNPWNTHDCAGVLDASNLTNGSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKLSDDI    211 - 280
GNFGEVRLPLLGCLGVSWLVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFDGIMYYLTP    281 - 350
QWDKILEAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGF    351 - 420
MANHLGVDVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEVGN    421 - 490
EWILQKKTYVTLGVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVISCIMCVAIMYIYGHRNYFQDI    491 - 560
QMMLGFPPPLFFQICWRFVSPAIIFFILVFTVIQYQPITYNHYQYPGWAVAIGFLMALSSVLCIPLYAMF    561 - 630
RLCRTDGDTLLQRLKNATKPSRDWGPALLEHRTGRYAPTIAPSPEDGFEVQPLHPDKAQIPIVGSNGSSR    631 - 700
LQDSRI                                                                    701 - 706
//

Text Mined References (31)

PMID Year Title
26302655 2015 Glycine transporter 1 is a target for the treatment of epilepsy.
24962325 2014 Genome-wide survival analysis of age at onset of alcohol dependence in extended high-risk COGA families.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23132267 2013 Glycine transporter type 1 occupancy by bitopertin: a positron emission tomography study in healthy volunteers.
22705056 2012 Molecular basis for differential glycine transporters sensitivity to sanguinarine.
22425803 2012 Interactions between glycine transporter type 1 (GlyT-1) and some inhibitor molecules - glycine transporter type 1 and its inhibitors (review).
21688322 2011 Translational characterization of [11C]GSK931145, a PET ligand for the glycine transporter type 1.
21628872 2011 The glycine transporter GLYT1 in human intestine: expression and function.
19650813 2009 No association of alcohol dependence with SLC6A5 and SLC6A9 glycine transporter polymorphisms.
19556729 2009 Association of SLC6A9 gene variants with human essential hypertension.
More...