Property Summary

NCBI Gene PubMed Count 17
PubMed Score 175.11
PubTator Score 19.20

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.200 2.3e-05
atypical teratoid / rhabdoid tumor -1.900 6.6e-06
glioblastoma -1.200 7.7e-03
group 3 medulloblastoma -1.700 1.1e-02
medulloblastoma, large-cell -1.800 1.2e-04
non primary Sjogren syndrome sicca -1.400 2.3e-02

Gene RIF (11)

AA Sequence

MTAEKALPLGNGKAAEEARESEAPGGGCSSGGAAPARHPRVKRDKAVHERGHWNNKVEFVLSVAGEIIGL      1 - 70
GNVWRFPYLCYKNGGGAFLIPYVVFFICCGIPVFFLETALGQFTSEGGITCWRKVCPLFEGIGYATQVIE     71 - 140
AHLNVYYIIILAWAIFYLSNCFTTELPWATCGHEWNTENCVEFQKLNVSNYSHVSLQNATSPVMEFWEHR    141 - 210
VLAISDGIEHIGNLRWELALCLLAAWTICYFCIWKGTKSTGKVVYVTATFPYIMLLILLIRGVTLPGASE    211 - 280
GIKFYLYPDLSRLSDPQVWVDAGTQIFFSYAICLGCLTALGSYNNYNNNCYRDCIMLCCLNSGTSFVAGF    281 - 350
AIFSVLGFMAYEQGVPIAEVAESGPGLAFIAYPKAVTMMPLSPLWATLFFMMLIFLGLDSQFVCVESLVT    351 - 420
AVVDMYPKVFRRGYRRELLILALSVISYFLGLVMLTEGGMYIFQLFDSYAASGMCLLFVAIFECICIGWV    421 - 490
YGSNRFYDNIEDMIGYRPPSLIKWCWMIMTPGICAGIFIFFLIKYKPLKYNNIYTYPAWGYGIGWLMALS    491 - 560
SMLCIPLWICITVWKTEGTLPEKLQKLTTPSTDLKMRGKLGVSPRMVTVNDCDAKLKSDGTIAAITEKET    561 - 630
HF                                                                        631 - 632
//

Text Mined References (19)

PMID Year Title