Property Summary

Ligand Count 1
NCBI Gene PubMed Count 23
PubMed Score 211.97
PubTator Score 41.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Neoplasm Invasiveness 161 0.0 0.0
Disease Target Count
Schizophrenia 1160
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma -1.100 3.8e-03
ovarian cancer 1.500 3.0e-07
pancreatic ductal adenocarcinoma liver m... -1.450 8.8e-03

Gene RIF (11)

AA Sequence

MDGKVAVQECGPPAVSWVPEEGEKLDQEDEDQVKDRGQWTNKMEFVLSVAGEIIGLGNVWRFPYLCYKNG      1 - 70
GGAFFIPYFIFFFVCGIPVFFLEVALGQYTSQGSVTAWRKICPLFQGIGLASVVIESYLNVYYIIILAWA     71 - 140
LFYLFSSFTSELPWTTCNNFWNTEHCTDFLNHSGAGTVTPFENFTSPVMEFWERRVLGITSGIHDLGSLR    141 - 210
WELALCLLLAWVICYFCIWKGVKSTGKVVYFTATFPYLMLVILLIRGVTLPGAYQGIIYYLKPDLFRLKD    211 - 280
PQVWMDAGTQIFFSFAICQGCLTALGSYNKYHNNCYKDCIALCFLNSATSFVAGFVVFSILGFMSQEQGV    281 - 350
PISEVAESGPGLAFIAFPKAVTMMPLSQLWSCLFFIMLIFLGLDSQFVCVECLVTASIDMFPRQLRKSGR    351 - 420
RELLILTIAVMCYLIGLFLVTEGGMYIFQLFDYYASSGICLLFLSLFEVVCISWVYGADRFYDNIEDMIG    421 - 490
YRPWPLVKISWLFLTPGLCLATFLFSLSKYTPLKYNNVYVYPPWGYSIGWFLALSSMVCVPLFVVITLLK    491 - 560
TRGPFRKRLRQLITPDSSLPQPKQHPCLDGSAGRNFGPSPTREGLIAGEKETHL                    561 - 614
//

Text Mined References (25)

PMID Year Title