Property Summary

NCBI Gene PubMed Count 1,027
Grant Count 1,414
R01 Count 800
Funding $125,747,735.02
PubMed Score 2853.24
PubTator Score 1837.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (58)

Disease Z-score Confidence
Cancer 2,346 5.931 3.0
Acquired immunodeficiency syndrome 164 4.645 2.3
Myocardial Infarction 126 4.507 2.3
Arthritis 248 3.809 1.9
Cerebrovascular disease 231 3.532 1.8
Multiple Sclerosis 498 3.401 1.7
Atherosclerosis 275 3.327 1.7
Agammaglobulinemia 24 3.312 1.7
Hypersensitivity reaction type II diseas... 235  3.22 1.6
interstitial lung disease 291 3.204 1.6
diabetes mellitus 1,663 3.096 1.5
Eye disease 55 3.038 1.5
Alzheimer's disease 644
Atopic dermatitis 944
Breast cancer 3,094
Cardiovascular system disease 194 2.0
Chronic Periodontitis 2
Coronary artery disease 240
Duchenne muscular dystrophy 602
HIV Infections 100
Ischemia 27
Liver carcinoma 217
Mammary Neoplasms 410
Neoplasm Invasiveness 127
Neoplasm Metastasis 138
Pick disease 1,893
Prostatic Neoplasms 471
Schizophrenia 501 1.0
Waldenstrons macroglobulinemia 765
adrenocortical carcinoma 1,427
aldosterone-producing adenoma 664
atypical teratoid / rhabdoid tumor 4,369
breast carcinoma 1,614
colon cancer 1,475
cystic fibrosis 1,665
ductal carcinoma in situ 1,745
fibroadenoma 557
glioblastoma 5,572
interstitial cystitis 2,299
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
limb girdle muscular dystrophy 2A 156
lung adenocarcinoma 2,713
lung cancer 4,466
lung carcinoma 2,844
medulloblastoma, large-cell 6,234
mucosa-associated lymphoid tissue lympho... 480 
non-small cell lung cancer 2,798
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic cancer 2,300
pancreatic ductal adenocarcinoma liver m... 1,795 
periodontitis 269
primary Sjogren syndrome 789
sonic hedgehog group medulloblastoma 1,482
subependymal giant cell astrocytoma 2,287

Expression

Synonym

Accession P48061 B2R4G0 E7EVL0 H7BYN8 Q2L985 Q2L986 Q2L988 Q5IT36 Q6ICW0 Q9H554 SDF-1
Symbols IRH
PBSF
SDF1
TLSF
TPAR1
SCYB12

Gene

PDB

2K03   2K04   2K05   2N55   1A15   1QG7   1SDF   1VMC   2J7Z   2K01   2KEC   2KED   2KEE   2KOL   2NWG   2SDF   3GV3   3HP3   4LMQ   4UAI  

Gene RIF (1076)

PMID Text
27041792 Study shows that serum concentrations of CXCL12 were significantly higher, while those of its receptor CXCR4 were significantly lower in esophageal cancer (EC) patients suggesting that suggest that serum CXCR4 and CXCl12 may improve the diagnosis of EC patients.
26896000 Study suggests that CXCR4-SDF-1 axis is involved in mobilization and trafficking of epithelial circulating tumor cells in primary breast cancer.
26851944 Data suggest targeting the stromal cell-derived factor-1 (SDF-1)/chemokine receptor 4 (CXCR4) axis might provide a therapeutic strategy for endometrial cancer (EC) treatment.
26818832 Membranous expression of SDF-1 was a marker of poor prognosis and proved to be an independent prognostic parameter for the entire cohort and for patients with adenocarcinoma
26806619 Cell migration towards CXCL12 in leukemic cells compared to breast cancer cells.
26782945 overexpression of SDF-1 enhanced EMT by activating the NF-kappaB pathway of MCF-7 cells and further induced the formation of CSC-like phenotypes, ultimately promoting the proliferation and metastasis of MCF-7 cells
26782415 these results indicate that the chemokine receptor CXCR4 and its ligand CXCL12 play important roles in the occurrence and development of bladder cancer.
26782381 We conclude that the CXCL12 G801A polymorphism is a risk factor that increases susceptibility to gliomas in a subset of the general Han Chinese population.
26722521 In breast cancer patients, CXCL12 exhibited significant differences in expression between primary tumor and lymph node metastasis tumor
26722422 CXCL12 could trigger epithelial to mesenchymal transition of breast cancer cells.
More...

AA Sequence

MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQV      1 - 70
CIDPKLKWIQEYLEKALNKRFKM                                                    71 - 93
//

Text Mined References (1037)

PMID Year Title
27041792 2016 The Serum Concentrations of Chemokine CXCL12 and Its Specific Receptor CXCR4 in Patients with Esophageal Cancer.
26896000 2016 CXCR4-SDF-1 interaction potentially mediates trafficking of circulating tumor cells in primary breast cancer.
26851944 2016 Cancer-associated fibroblasts promote the progression of endometrial cancer via the SDF-1/CXCR4 axis.
26818832 2016 Expression of the CXCR4 ligand SDF-1/CXCL12 is prognostically important for adenocarcinoma and large cell carcinoma of the lung.
26806619 2016 Cell migration towards CXCL12 in leukemic cells compared to breast cancer cells.
26782945 2016 Overexpression of SDF-1 activates the NF-?B pathway to induce epithelial to mesenchymal transition and cancer stem cell-like phenotypes of breast cancer cells.
26782415 2015 Chemokine receptor CXCR4 and its ligand CXCL12 expressions and clinical significance in bladder cancer.
26782381 2015 CXCL12 G801A polymorphism and susceptibility to glioma: a case?control study.
26722521 2015 Prognostic significance of CXCL12, CXCR4, and CXCR7 in patients with breast cancer.
26722422 2015 Wnt/?-catenin pathway is required for epithelial to mesenchymal transition in CXCL12 over expressed breast cancer cells.
More...