Property Summary

NCBI Gene PubMed Count 33
PubMed Score 32.80
PubTator Score 34.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (31)

Disease log2 FC p
adult high grade glioma 1.100 1.9e-02
aldosterone-producing adenoma -1.084 3.6e-02
Astrocytoma, Pilocytic 1.600 8.3e-07
atypical teratoid / rhabdoid tumor -1.200 8.7e-04
Breast cancer -1.300 1.2e-13
chronic kidney disease 1.100 3.7e-02
cutaneous lupus erythematosus 1.500 5.3e-03
cystic fibrosis 1.500 2.3e-03
diabetes mellitus -1.400 2.2e-02
gastric carcinoma 1.600 2.7e-02
glioblastoma 1.300 8.2e-04
group 3 medulloblastoma -1.200 1.3e-02
head and neck cancer -1.200 9.0e-03
interstitial cystitis 1.300 6.3e-04
intraductal papillary-mucinous adenoma (... -2.000 6.2e-03
intraductal papillary-mucinous carcinoma... -1.100 1.4e-02
lung cancer -1.300 1.7e-04
lung carcinoma -2.300 4.6e-27
malignant mesothelioma -1.900 5.6e-08
medulloblastoma, large-cell -1.700 9.2e-05
oligodendroglioma -1.100 3.6e-02
osteosarcoma -1.163 4.5e-02
ovarian cancer -1.400 1.6e-07
pancreatic cancer 1.200 2.9e-02
posterior fossa group A ependymoma 1.300 2.4e-03
primary pancreatic ductal adenocarcinoma 1.032 3.8e-02
primary Sjogren syndrome 1.300 1.1e-03
psoriasis -1.800 8.2e-05
subependymal giant cell astrocytoma 2.521 1.4e-02
tuberculosis and treatment for 6 months -1.200 2.8e-02
ulcerative colitis 1.300 1.0e-03

Gene RIF (23)

AA Sequence

MRVTLATIAWMVSFVSNYSHTANILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKA      1 - 70
WASNCQFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDEIQDYDFKTRICKKVCGHYTQ     71 - 140
VVWADSYKVGCAVQFCPKVSGFDALSNGAHFICNYGPGGNYPTWPYKRGATCSACPNNDKCLDNLCVNRQ    141 - 210
RDQVKRYYSVVYPGWPIYPRNRYTSLFLIVNSVILILSVIITILVQHKYPNLVLLD                  211 - 266
//

Text Mined References (33)

PMID Year Title