Property Summary

NCBI Gene PubMed Count 31
Grant Count 21
R01 Count 10
Funding $3,553,449.8
PubMed Score 31.05
PubTator Score 34.58

Knowledge Summary

Patent

No data available

Expression

Gene RIF (21)

PMID Text
26988096 This study reveals a novel pathway that PRMT5/WDR77 regulates GLIPR1 expression to control lung cancer cell growth.
26305187 RTVP-1 regulates glioma cell spreading, migration and invasion and that these effects are mediated via interaction with N-WASP and by interfering with the inhibitory effect of hnRNPK on the function of this protein.
26267319 Overexpression of RTVP-1 in human neural stem cells induced mesenchymal differentiation, whereas silencing of RTVP-1 in glioma stem cells (GSCs) decreased the mesenchymal transformation and stemness of these cells.
24008279 Based on the observed overexpression in AML samples, GliPR1 should be further explored as a potential target for AML
23714687 miR-137 inhibits Glioblastom stem cell self-renewal and promotes their differentiation by targeting RTVP-1 which down-regulates CXCR4.
23433894 Data indicate that combining adenoviral vector-mediated GLIPR1 gene therap (AdGLIPR1) with radiotherapy may achieve additive or synergistic tumor control in selected prostate and bladder tumors.
23333597 GLIPR1 interacts with Hsc70, and GLIPR1 overexpression or Hsc70 knockdown leads to transcriptional suppression of AURKA and TPX2.
22025562 Data show that the expression of GLIPR1 and c-Myc were inversely correlated in prostate cancer.
21931216 GLIPR1 core structure has a conserved central cavity via which CAP proteins are likely to bind to shared ligands.
21922325 demonstrate that GLIPR1 is a methylation-silenced gene in the acute myeloid leukemia patients
More...

AA Sequence

MRVTLATIAWMVSFVSNYSHTANILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKA      1 - 70
WASNCQFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDEIQDYDFKTRICKKVCGHYTQ     71 - 140
VVWADSYKVGCAVQFCPKVSGFDALSNGAHFICNYGPGGNYPTWPYKRGATCSACPNNDKCLDNLCVNRQ    141 - 210
RDQVKRYYSVVYPGWPIYPRNRYTSLFLIVNSVILILSVIITILVQHKYPNLVLLD                  211 - 266
//

Text Mined References (31)

PMID Year Title
26988096 2016 GLI pathogenesis-related 1 functions as a tumor-suppressor in lung cancer.
26305187 2015 RTVP-1 regulates glioma cell migration and invasion via interaction with N-WASP and hnRNPK.
26267319 2015 RTVP-1 promotes mesenchymal transformation of glioma via a STAT-3/IL-6-dependent positive feedback loop.
24008279 2013 Endoplasmic reticulum protein GliPR1 regulates G protein signaling and the cell cycle and is overexpressed in AML.
23714687 2013 MicroRNA-137 is downregulated in glioblastoma and inhibits the stemness of glioma stem cells by targeting RTVP-1.
23433894 2014 Combined therapeutic effects of adenoviral vector-mediated GLIPR1 gene therapy and radiotherapy in prostate and bladder cancer models.
23333597 2013 Glioma pathogenesis-related protein 1 induces prostate cancer cell death through Hsc70-mediated suppression of AURKA and TPX2.
22025562 2011 GLIPR1 suppresses prostate cancer development through targeted oncoprotein destruction.
21931216 2011 Structural studies of human glioma pathogenesis-related protein 1.
21922325 2011 Identification of GLIPR1 tumor suppressor as methylation-silenced gene in acute myeloid leukemia by microarray analysis.
More...