Property Summary

NCBI Gene PubMed Count 61
PubMed Score 5.00
PubTator Score 68.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 4.0e-04
atypical teratoid / rhabdoid tumor 1.300 9.9e-03
gastric cancer 1.100 2.9e-02
glioblastoma 1.100 2.0e-03
osteosarcoma 3.254 1.3e-09
ovarian cancer 1.500 4.6e-04
pancreatic cancer 1.400 1.0e-02
pancreatic carcinoma 1.400 1.0e-02
pediatric high grade glioma 1.600 4.2e-05
psoriasis 1.400 1.7e-04
tuberculosis and treatment for 6 months -1.600 8.9e-06
ulcerative colitis 1.200 2.0e-07

Protein-protein Interaction (10)

Gene RIF (29)

AA Sequence

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC      1 - 70
CHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKARGLGKYICQKCHA     71 - 140
IIDEQPLIFKNDPYHPDHFNCANCGKELTADARELKGELYCLPCHDKMGVPICGACRRPIEGRVVNAMGK    141 - 210
QWHVEHFVCAKCEKPFLGHRHYERKGLAYCETHYNQLFGDVCFHCNRVIEGDVVSALNKAWCVNCFACST    211 - 280
CNTKLTLKNKFVEFDMKPVCKKCYEKFPLELKKRLKKLAETLGRK                             281 - 325
//

Text Mined References (62)

PMID Year Title