Property Summary

NCBI Gene PubMed Count 59
Grant Count 89
R01 Count 68
Funding $11,076,487.65
PubMed Score 5.00
PubTator Score 68.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
gastric cancer 1.100 0.029
pancreatic cancer 1.400 0.010
psoriasis 1.400 0.000
osteosarcoma 3.254 0.000
glioblastoma 1.700 0.001
atypical teratoid / rhabdoid tumor 1.300 0.010
tuberculosis and treatment for 6 months -1.600 0.000
pediatric high grade glioma 1.600 0.000
pilocytic astrocytoma 1.200 0.001
pancreatic carcinoma 1.400 0.010
ulcerative colitis 1.200 0.000
ovarian cancer 1.500 0.000

Synonym

Accession P48059 B2RAJ4 B7Z483 B7Z7R3 B7Z907 Q53TE0 Q9BS44
Symbols PINCH
PINCH1
PINCH-1

Gene

PDB

2KBX   3F6Q   4HI8   4HI9   1U5S   1G47   1NYP   2COR   2D8X  

Gene RIF (28)

PMID Text
26460618 our data suggest an essential role of PINCH1, ILK and ILKAP for the radioresistance of p53-wildtype glioblastoma multiforme cells
26004008 Data suggest that PINCH1 and Nck2 critically participate in the regulation of cellular radiosensitivity and EGFR function and downstream signaling in a cellular model of human squamous cell carcinoma.
25647720 Downregulation of PINCH1 is associated with metastatic breast cancer.
24895689 two novel genes, galectin 9 and PINCH, were expressed at much higher levels in cancerous lesions than in normal tissues in all the patients with clear-cell carcinoma who were examined
24817145 changes in CSF levels of PINCH appear to correlate with changes in blood CD4 count and with changes in CSF hyperphosphorylated Tau levels
23970013 PINCH predicts survival in rectal cancer patients with RT, but not in patients without RT. The expression of PINCH may be regulated by radiation and by environmental factors surrounding the cells.
23554879 PINCH is increased and binds to hp-Tau. These studies address a new mechanism by which AD and HIV may intersect and identify PINCH as a contributing factor to the accumulation of hyperphosphorylated Tau.
22976000 PINCH protein might play an important role in the tumourigenesis and metastasis of gastric adenocarcinoma.
22310984 Pinch-1 mRNA and protein were significantly up-regulated in acute lymphoblastic leukemia and acute myeloid leukemia bone marrow stromal cells compared to normal bone marrow stromal cells (p<0.01).
22199270 PINCH mRNA overexpression in colorectal carcinomas is correlated with VEGF and FAS mRNA expression
More...

AA Sequence

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC      1 - 70
CHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKARGLGKYICQKCHA     71 - 140
IIDEQPLIFKNDPYHPDHFNCANCGKELTADARELKGELYCLPCHDKMGVPICGACRRPIEGRVVNAMGK    141 - 210
QWHVEHFVCAKCEKPFLGHRHYERKGLAYCETHYNQLFGDVCFHCNRVIEGDVVSALNKAWCVNCFACST    211 - 280
CNTKLTLKNKFVEFDMKPVCKKCYEKFPLELKKRLKKLAETLGRK                             281 - 325
//

Text Mined References (60)

PMID Year Title
26460618 2015 ILKAP, ILK and PINCH1 control cell survival of p53-wildtype glioblastoma cells after irradiation.
26004008 2015 Targeting of the EGFR/?1 integrin connecting proteins PINCH1 and Nck2 radiosensitizes three-dimensional SCC cell cultures.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25647720 2015 Ras suppressor-1 promotes apoptosis in breast cancer cells by inhibiting PINCH-1 and activating p53-upregulated-modulator of apoptosis (PUMA); verification from metastatic breast cancer human samples.
25416956 2014 A proteome-scale map of the human interactome network.
24895689 2014 Galectin 9 and PINCH, novel immunotherapy targets of renal cell carcinoma: a rationale to find potential tumour antigens and the resulting cytotoxic T lymphocytes induced by the derived peptides.
24817145 2014 Changes in PINCH levels in the CSF of HIV+ individuals correlate with hpTau and CD4 count.
23970013 2013 PINCH expression in relation to radiation response in co-cultured colon cancer cells and in rectal cancer patients.
23877428 2013 Interaction of smoothened with integrin-linked kinase in primary cilia mediates Hedgehog signalling.
23554879 2013 PINCH in the cellular stress response to tau-hyperphosphorylation.
More...