Property Summary

NCBI Gene PubMed Count 53
Grant Count 53
R01 Count 23
Funding $5,313,789.32
PubMed Score 246.00
PubTator Score 107.05

Knowledge Summary

Patent (5,598)

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma 1.900 0.019
ependymoma -2.200 0.002
oligodendroglioma 2.500 0.003
glioblastoma -3.200 0.004
group 4 medulloblastoma -5.200 0.000
atypical teratoid / rhabdoid tumor -4.300 0.000
medulloblastoma, large-cell -5.200 0.000
primitive neuroectodermal tumor -2.900 0.010
pediatric high grade glioma -2.600 0.002
pilocytic astrocytoma 1.300 0.000
subependymal giant cell astrocytoma -2.679 0.027
Pick disease -1.500 0.011
Breast cancer -1.500 0.000
gastric carcinoma -1.600 0.008
pituitary cancer 3.500 0.000
psoriasis -1.700 0.000

Synonym

Accession P48058 Q86XE8 GluR-4
Symbols GLUR4
GLURD
GluA4
GLUR4C

Gene

  TechDev Info (1)

Susumu Tomita Modulation of Synaptic activity

Gene RIF (27)

PMID Text
26744192 A transient positive feedback mechanism between AMPAR and stargazin has implications for information processing in the brain, because it should allow activity-dependent facilitation of excitatory synaptic transmission through a postsynaptic mechanism.
25433904 This study demonstrated that the GRIA4 protein was altered in auditory cortex patient with schizophreia.
24962026 Interaction with the alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid receptor subunit GluR4.
24652293 The N-terminal domain modulates alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptor desensitization.
24512576 Statistical analysis showed no association between migraine and the GRIA2 and GRIA4 polymorphisms investigated.
24292102 the levels were comparable for complexes containing GluR2, GluR3 and GluR4 as well as 5-HT1A. Moreover, the levels of complexes containing muscarinic AChR M1, NR1 and GluR1 were significantly increased in male patients with AD.
23613500 The data potentially suggest a lack of epistatic interaction between GRIA2 and GRIA4 variants regarding clinical outcomes in patients with major depressive disorder.
22122651 SNPs within GRIA4 may not be associated with the development and treatment outcomes in BD
22094384 No significant association GRIA4 polymorphisms was found with the diagnosis of schizophrenia.
22057216 Did not observed any significant association between GRIA4 polymorphisms and clinical improvement in patients with Major depressive disorder.
More...

AA Sequence

MRIISRQIVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVPHVDN      1 - 70
IETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPSFPTEGESQFVLQLRPSLRG     71 - 140
ALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWHVSAICVENFNDVSYRQLLEELDRRQEKKFV    141 - 210
IDCEIERLQNILEQIVSVGKHVKGYHYIIANLGFKDISLERFIHGGANVTGFQLVDFNTPMVIKLMDRWK    211 - 280
KLDQREYPGSETPPKYTSALTYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLK    281 - 350
QVRIQGLTGNVQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDVPTLGNDTAAIENRTVVVT    351 - 420
TIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELV    421 - 490
YGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSV    491 - 560
VLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFF    561 - 630
TLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAE    631 - 700
PSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRTPVNL    701 - 770
AVLKLSEAGVLDKLKNKWWYDKGECGPKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKS    771 - 840
RAEAKRMKLTFSEAIRNKARLSITGSVGENGRVLTPDCPKAVHTGTAIRQSSGLAVIASDLP            841 - 902
//

Text Mined References (55)

PMID Year Title
26744192 2016 Superactivation of AMPA receptors by auxiliary proteins.
25433904 2015 Altered glutamate protein co-expression network topology linked to spine loss in the auditory cortex of schizophrenia.
24962026 2014 Neuronal pentraxin 2 supports clear cell renal cell carcinoma by activating the AMPA-selective glutamate receptor-4.
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24652293 2014 The N-terminal domain modulates ?-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptor desensitization.
24512576 2014 Genetic analysis of GRIA2 and GRIA4 genes in migraine.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24292102 2014 Changes of several brain receptor complexes in the cerebral cortex of patients with Alzheimer disease: probable new potential pharmaceutical targets.
23613500 2013 Investigation of possible epistatic interactions between GRIA2 and GRIA4 variants on clinical outcomes in patients with major depressive disorder.
23396134 2013 Genome-wide meta-analyses of multiancestry cohorts identify multiple new susceptibility loci for refractive error and myopia.
More...