Property Summary

NCBI Gene PubMed Count 21
Grant Count 8
R01 Count 6
Funding $309,615.99
PubMed Score 52.16
PubTator Score 30.13

Knowledge Summary

Patent

No data available

Expression

Gene RIF (9)

PMID Text
26316592 This study showed that CPA2 and CPB1 variants are not associated with chronic pancreatitis.
26115097 CPMG RD data analysis thus allowed a detailed structural characterization of the ADA2h denatured state under folding conditions not previously achieved for this protein.
21098023 Chymotrypsin C is a co-activator of human pancreatic procarboxypeptidases A1 and A2.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19817500 we have used one of the best-characterized models for folding and misfolding, the activation domain of procarboxypeptidase A2. The wild type (WT) and three mutants affecting the kinetics of aggregation have been studied by IR from the folded state
19401682 Observational study of gene-disease association. (HuGE Navigator)
17196978 The high-resolution crystal structure and solution NMR structure of AYEdesign show that the experimentally determined backbone and side-chains conformations are effectively superimposable with the computational model at atomic resolution.
12538893 NMR structure of the activation domain
11743734 changes in zinc ligation promote remodeling of the active site in the zinc hydrolase superfamily

AA Sequence

MAMRLILFFGALFGHIYCLETFVGDQVLEIVPSNEEQIKNLLQLEAQEHLQLDFWKSPTTPGETAHVRVP      1 - 70
FVNVQAVKVFLESQGIAYSIMIEDVQVLLDKENEEMLFNRRRERSGNFNFGAYHTLEEISQEMDNLVAEH     71 - 140
PGLVSKVNIGSSFENRPMNVLKFSTGGDKPAIWLDAGIHAREWVTQATALWTANKIVSDYGKDPSITSIL    141 - 210
DALDIFLLPVTNPDGYVFSQTKNRMWRKTRSKVSGSLCVGVDPNRNWDAGFGGPGASSNPCSDSYHGPSA    211 - 280
NSEVEVKSIVDFIKSHGKVKAFITLHSYSQLLMFPYGYKCTKLDDFDELSEVAQKAAQSLRSLHGTKYKV    281 - 350
GPICSVIYQASGGSIDWSYDYGIKYSFAFELRDTGRYGFLLPARQILPTAEETWLGLKAIMEHVRDHPY     351 - 419
//

Text Mined References (24)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26316592 2015 Variants in pancreatic carboxypeptidase genes CPA2 and CPB1 are not associated with chronic pancreatitis.
26115097 2015 Probing the Residual Structure of the Low Populated Denatured State of ADA2h under Folding Conditions by Relaxation Dispersion Nuclear Magnetic Resonance Spectroscopy.
21098023 2011 Chymotrypsin C is a co-activator of human pancreatic procarboxypeptidases A1 and A2.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19817500 2009 Influence of aggregation propensity and stability on amyloid fibril formation as studied by Fourier transform infrared spectroscopy and two-dimensional COS analysis.
19401682 2010 High-density SNP association study and copy number variation analysis of the AUTS1 and AUTS5 loci implicate the IMMP2L-DOCK4 gene region in autism susceptibility.
17196978 2007 High-resolution structural and thermodynamic analysis of extreme stabilization of human procarboxypeptidase by computational protein design.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15203218 2004 Circular rapid amplification of cDNA ends for high-throughput extension cloning of partial genes.
More...