Property Summary

NCBI Gene PubMed Count 55
Grant Count 36
R01 Count 24
Funding $5,201,134.6
PubMed Score 178.14
PubTator Score 103.53

Knowledge Summary

Patent (6,689)

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -3.000 0.001
ependymoma -5.100 0.000
oligodendroglioma -2.800 0.008
glioblastoma -5.200 0.000
group 3 medulloblastoma -4.200 0.000
atypical teratoid / rhabdoid tumor -5.700 0.000
medulloblastoma, large-cell -4.400 0.000
primitive neuroectodermal tumor -4.100 0.000
pediatric high grade glioma -4.600 0.000
pilocytic astrocytoma -5.000 0.000
subependymal giant cell astrocytoma -2.092 0.030
lung carcinoma 4.300 0.000
pituitary cancer -3.800 0.000
psoriasis 1.100 0.000

Gene RIF (33)

PMID Text
26032891 In this transgenic mouse model, GIRK2 plays a major role in the genesis of infantile spasms.
25620207 Keppen-Lubinsky syndrome is caused by mutations in the inwardly rectifying K+ channel encoded by KCNJ6.
25599232 The findings of this study suggest that variations in KCNJ6 genes are associated with both mild and severe persistent breast pain after breast cancer surgery.
25346042 KCNJ6 (GIRK2) gene polymorphism rs2835859 could serve as a marker that predicts sensitivity to analgesics and pain and susceptibility to nicotine dependence.
24392765 For KCNJ6, three SNPs (i.e., rs2835914, rs8129919, rs2836050) were associated with the occurrence of preoperative breast pain.
24145411 Ethanol associates directly with the GIRK channel, leading to enhanced interaction with a membrane phospholipid phosphatidylinositol 4,5-bisphosphate and activation of the channel.
23994450 Eight KCNNJ6 single nucleotide polymorphisms(SNPs) are significantly associated with pain-related phenotypes.
23739333 3.5 A resolution crystal structure of the mammalian GIRK2 channel in complex with betagamma G-protein subunits, the central signalling complex that links G-protein-coupled receptor stimulation to K(+) channel activity
23175530 Conformational information encoded by ligand binding to delta-opioid receptors (DORs) is transmitted to Kir3.1/Kir3.2 channels.
22554406 KCNJ6 (or its product GIRK2) accounts for some of the variations in frontal theta; band oscillations.
More...

AA Sequence

MAKLTESMTNVLEGDSMDQDVESPVAIHQPKLPKQARDDLPRHISRDRTKRKIQRYVRKDGKCNVHHGNV      1 - 70
RETYRYLTDIFTTLVDLKWRFNLLIFVMVYTVTWLFFGMIWWLIAYIRGDMDHIEDPSWTPCVTNLNGFV     71 - 140
SAFLFSIETETTIGYGYRVITDKCPEGIILLLIQSVLGSIVNAFMVGCMFVKISQPKKRAETLVFSTHAV    141 - 210
ISMRDGKLCLMFRVGDLRNSHIVEASIRAKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIIS    211 - 280
HEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVD    281 - 350
YNSFHETYETSTPSLSAKELAELASRAELPLSWSVSSKLNQHAELETEEEEKNLEEQTERNGDVANLENE    351 - 420
SKV                                                                       421 - 423
//

Text Mined References (55)

PMID Year Title
26032891 2015 The GIRK2 subunit is involved in IS-like seizures induced by GABA(B) receptor agonists.
25620207 2015 Keppen-Lubinsky syndrome is caused by mutations in the inwardly rectifying K+ channel encoded by KCNJ6.
25599232 2015 Variations in potassium channel genes are associated with distinct trajectories of persistent breast pain after breast cancer surgery.
25346042 2014 Association between KCNJ6 (GIRK2) gene polymorphism rs2835859 and post-operative analgesia, pain sensitivity, and nicotine dependence.
24392765 Variations in potassium channel genes are associated with breast pain in women prior to breast cancer surgery.
24145411 2013 Molecular mechanism underlying ethanol activation of G-protein-gated inwardly rectifying potassium channels.
23994450 2013 Associations between KCNJ6 (GIRK2) gene polymorphisms and pain-related phenotypes.
23739333 2013 X-ray structure of the mammalian GIRK2-?? G-protein complex.
23175530 2013 Conformational dynamics of Kir3.1/Kir3.2 channel activation via ?-opioid receptors.
22554406 2012 Family-based genome-wide association study of frontal ? oscillations identifies potassium channel gene KCNJ6.
More...