Property Summary

Ligand Count 1
NCBI Gene PubMed Count 34
PubMed Score 84.92
PubTator Score 71.20

Knowledge Summary

Patent (3,262)

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.700 1.2e-02
astrocytic glioma -2.800 1.1e-03
Astrocytoma, Pilocytic -3.200 1.9e-04
atypical teratoid / rhabdoid tumor -2.800 5.0e-06
ependymoma -3.500 4.8e-04
glioblastoma -2.300 2.4e-04
group 4 medulloblastoma -1.500 3.1e-02
medulloblastoma, large-cell -3.300 4.5e-03
oligodendroglioma -2.600 6.0e-03
Pick disease -1.100 6.9e-03
pituitary cancer -1.300 4.1e-07
primitive neuroectodermal tumor -2.700 8.8e-03
psoriasis -1.200 3.0e-08

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (9)

AA Sequence

MHGHSRNGQAHVPRRKRRNRFVKKNGQCNVYFANLSNKSQRYMADIFTTCVDTRWRYMLMIFSAAFLVSW      1 - 70
LFFGLLFWCIAFFHGDLEASPGVPAAGGPAAGGGGAAPVAPKPCIMHVNGFLGAFLFSVETQTTIGYGFR     71 - 140
CVTEECPLAVIAVVVQSIVGCVIDSFMIGTIMAKMARPKKRAQTLLFSHHAVISVRDGKLCLMWRVGNLR    141 - 210
KSHIVEAHVRAQLIKPYMTQEGEYLPLDQRDLNVGYDIGLDRIFLVSPIIIVHEIDEDSPLYGMGKEELE    211 - 280
SEDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVVFEEKSHYKVDYSRFHKTYEVAGTPCCSA    281 - 350
RELQESKITVLPAPPPPPSAFCYENELALMSQEEEEMEEEAAAAAAVAAGLGLEAGSKEEAGIIRMLEFG    351 - 420
SHLDLERMQASLPLDNISYRRESAI                                                 421 - 445
//

Text Mined References (35)

PMID Year Title