Property Summary

NCBI Gene PubMed Count 34
Grant Count 25
R01 Count 21
Funding $2,276,472.19
PubMed Score 80.15
PubTator Score 71.20

Knowledge Summary

Patent (3,262)

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -2.800 0.001
ependymoma -3.500 0.000
oligodendroglioma -2.600 0.006
glioblastoma -3.500 0.000
medulloblastoma -2.700 0.001
atypical teratoid / rhabdoid tumor -2.800 0.000
medulloblastoma, large-cell -3.300 0.005
primitive neuroectodermal tumor -2.700 0.009
pediatric high grade glioma -2.500 0.003
pilocytic astrocytoma -3.100 0.000
Pick disease -1.100 0.007
pituitary cancer -1.300 0.000
psoriasis -1.200 0.000

Gene RIF (9)

PMID Text
22396414 Increased excitability and decreased dendritic arborization are associated with downregulation of inward rectifier potassium channels (Kir2.1/2.3).
20424473 Observational study of gene-disease association. (HuGE Navigator)
19635485 TIP-1 may act as an important regulator for the endocytic pathway of Kir2.3.
18503768 The data suggest that Kir2.3 plays a potentially important role in I(K1) currents in neonatal rat cardiomyocytes.
18453743 possibility of intramolecular interactions of the residue Kir2.3(H117) with conserved cysteines in close proximity to the selectivity filter
18180291 Kir2.3 is internalized by an AP-2 clathrin-dependent mechanism.
16373386 In conclusion, the data are consistent with the universal mechanism of rectification in Kir2 channels, but also point to significant, and physiologically important, quantitative differences between Kir2 isoforms.
16258766 Results describe the regulation of inwardly rectifying potassium current and its main molecular correlates, Kir2.1, Kir2.2 and Kir2.3 channels, by endothelin-1 in human atrial cardiomyocytes.
15958527 Kir2.2 and Kir2.1 are primary determinants of endogenous K(+) conductance in HAECs under resting conditions and that Kir2.2 provides the dominant conductance in these cells.

AA Sequence

MHGHSRNGQAHVPRRKRRNRFVKKNGQCNVYFANLSNKSQRYMADIFTTCVDTRWRYMLMIFSAAFLVSW      1 - 70
LFFGLLFWCIAFFHGDLEASPGVPAAGGPAAGGGGAAPVAPKPCIMHVNGFLGAFLFSVETQTTIGYGFR     71 - 140
CVTEECPLAVIAVVVQSIVGCVIDSFMIGTIMAKMARPKKRAQTLLFSHHAVISVRDGKLCLMWRVGNLR    141 - 210
KSHIVEAHVRAQLIKPYMTQEGEYLPLDQRDLNVGYDIGLDRIFLVSPIIIVHEIDEDSPLYGMGKEELE    211 - 280
SEDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVVFEEKSHYKVDYSRFHKTYEVAGTPCCSA    281 - 350
RELQESKITVLPAPPPPPSAFCYENELALMSQEEEEMEEEAAAAAAVAAGLGLEAGSKEEAGIIRMLEFG    351 - 420
SHLDLERMQASLPLDNISYRRESAI                                                 421 - 445
//

Text Mined References (35)

PMID Year Title
24800985 2014 Genome-wide association study of maternal and inherited loci for conotruncal heart defects.
22396414 2012 Striatal D2 receptors regulate dendritic morphology of medium spiny neurons via Kir2 channels.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
19635485 2009 Molecular mechanism of inward rectifier potassium channel 2.3 regulation by tax-interacting protein-1.
18503768 2008 Kir2.3 knock-down decreases IK1 current in neonatal rat cardiomyocytes.
18453743 2008 Novel insights into the structural basis of pH-sensitivity in inward rectifier K+ channels Kir2.3.
18391953 2008 Rare independent mutations in renal salt handling genes contribute to blood pressure variation.
18180291 2008 AP-2-dependent internalization of potassium channel Kir2.3 is driven by a novel di-hydrophobic signal.
17185339 2007 Evidence for association of GABA(B) receptors with Kir3 channels and regulators of G protein signalling (RGS4) proteins.
16855024 2006 TIP-1 has PDZ scaffold antagonist activity.
More...