Property Summary

Ligand Count 138
NCBI Gene PubMed Count 52
PubMed Score 327.81
PubTator Score 178.48

Knowledge Summary

Patent (6,980)


  Disease (6)

Disease Target Count
Hypokalemia 52
Polyhydramnios 108
Hyperaldosteronism 35
Autosomal recessive predisposition 1442
Bartter syndrome, antenatal type 1 3
Big calvaria 147
Bulging forehead 66
Calcium pyrophosphate deposition disease 13
Cognitive delay 608
Constipation 181
Dehydration 40
Diarrhea 253
Dull intelligence 645
Dyschezia 135
Elevated plasma renin 9
Epilepsy 792
Failure to gain weight 365
Fetal polyuria 8
Fever 138
Frontal bossing 157
Generalized muscle weakness 57
Generalized osteopenia 99
Global developmental delay 608
Globe of eye large 20
Hyperactive renin-angiotensin system 8
Hypercalciuria 27
Hyperprostaglandinuria 2
Hypertensive disease 292
Hypochloremia (disorder) 6
Hypokalemic metabolic alkalosis 4
Impaired platelet aggregation 8
Impairment of urinary concentration 5
Increased calcium level in kidney 21
Increased head circumference 147
Increased plasma renin activity 8
Increased serum prostaglandin E2 2
Increased size of cranium 147
Increased size of palpebral fissures 9
Increased size of skull 147
Increased urinary chloride 5
Increased urinary potassium 5
Intellectual disability 1016
Large auricle 87
Large dysplastic ears 87
Large eyes 9
Large pinnae 87
Large prominent ears 87
Large protruding ears 87
Large, floppy ears 87
Low Birth Weights 69
Low intelligence 645
Low-to-normal blood pressure 2
Macrotia 87
Mental Retardation 645
Mental and motor retardation 608
Mental deficiency 645
Muscle Cramp 55
Nephrocalcinosis 35
Osteopenia 99
Paresthesia 32
Pediatric failure to thrive 365
Polydipsia 15
Polyuria 23
Poor school performance 645
Premature Birth 77
Premature birth of newborn 67
Prominent forehead 66
Renal juxtaglomerular cell hypertrophy/hyperplasia 2
Renal potassium wasting 5
Renal salt wasting 18
Seizures 596
Serum chloride level decreased (finding) 6
Short stature 531
Small for gestational age (disorder) 69
Tetany 18
Triangular face 58
Vomiting 116
Disease Target Count P-value
psoriasis 6694 5.1e-26
ovarian cancer 8519 3.4e-09
medulloblastoma, large-cell 6241 5.8e-04
adult high grade glioma 3801 2.1e-02
nephrosclerosis 333 3.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9


  Differential Expression (5)

Disease log2 FC p
adult high grade glioma 1.100 2.1e-02
medulloblastoma, large-cell 1.600 5.8e-04
nephrosclerosis -1.527 3.6e-02
ovarian cancer 1.300 3.4e-09
psoriasis -1.500 5.1e-26

Gene RIF (37)

AA Sequence

ETPHCAMCLYNEKDVRARMKRGYDNPNFILSEVNETDDTKM                                 351 - 391

Text Mined References (56)

PMID Year Title