Property Summary

NCBI Gene PubMed Count 27
Grant Count 17
R01 Count 16
Funding $4,050,170.2
PubMed Score 168.72
PubTator Score 63.85

Knowledge Summary

Patent

No data available

Expression

Gene RIF (13)

PMID Text
26876430 Upon IF1 interaction with the ATP synthase both the synthetic and hydrolytic activities of the engine of oxidative phosphorylation are inhibited. (Review)
23125841 Tandem affinity purification and mass spectrometry analysis identify mitochondrial F1 complex ATP synthase O subunit (ATP5O), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify mitochondrial F1 complex ATP synthase O subunit (ATP5O), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify mitochondrial F1 complex ATP synthase O subunit (ATP5O), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify mitochondrial F1 complex ATP synthase O subunit (ATP5O), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23046812 Sirt3 physically interacted with the OSCP and led to its subsequent deacetylation.
22190034 Tandem affinity purification and mass spectrometry analysis identify mitochondrial F1 complex ATP synthase O subunit (ATP5O), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
20877624 Observational study of gene-disease association. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)
19274082 Genetic variation and age are associated with skeletal muscle ATP5O mRNA expression and glucose disposal rate, suggesting that combinations of genetic and non-genetic factors may cause the reduced expression of ATP5O in type 2 diabetes muscle
More...

AA Sequence

MAAPAVSGLSRQVRCFSTSVVRPFAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILK      1 - 70
EPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVP     71 - 140
CTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMR    141 - 210
EIV                                                                       211 - 213
//

Text Mined References (31)

PMID Year Title
26876430 2016 The ATPase Inhibitory Factor 1 (IF1): A master regulator of energy metabolism and of cell survival.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23222517 2012 Seventy-five genetic loci influencing the human red blood cell.
23046812 2013 Regulation of mitochondrial F(o)F(1)ATPase activity by Sirt3-catalyzed deacetylation and its deficiency in human cells harboring 4977bp deletion of mitochondrial DNA.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21516116 2011 Next-generation sequencing to generate interactome datasets.
More...