Property Summary

NCBI Gene PubMed Count 27
PubMed Score 177.36
PubTator Score 63.85

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

AA Sequence

MAAPAVSGLSRQVRCFSTSVVRPFAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILK      1 - 70
EPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVP     71 - 140
CTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMR    141 - 210
EIV                                                                       211 - 213
//

Text Mined References (31)

PMID Year Title