Property Summary

Ligand Count 584
NCBI Gene PubMed Count 77
PubMed Score 58.71
PubTator Score 88.42

Knowledge Summary

Patent (4,665)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 3.600 1.3e-34

Gene RIF (59)

AA Sequence

MQGNGSALPNASQPVLRGDGARPSWLASALACVLIFTIVVDILGNLLVILSVYRNKKLRNAGNIFVVSLA      1 - 70
VADLVVAIYPYPLVLMSIFNNGWNLGYLHCQVSGFLMGLSVIGSIFNITGIAINRYCYICHSLKYDKLYS     71 - 140
SKNSLCYVLLIWLLTLAAVLPNLRAGTLQYDPRIYSCTFAQSVSSAYTIAVVVFHFLVPMIIVIFCYLRI    141 - 210
WILVLQVRQRVKPDRKPKLKPQDFRNFVTMFVVFVLFAICWAPLNFIGLAVASDPASMVPRIPEWLFVAS    211 - 280
YYMAYFNSCLNAIIYGLLNQNFRKEYRRIIVSLCTARVFFVDSSNDVADRVKWKPSPLMTNNNVVKVDSV    281 - 350
//

Text Mined References (77)

PMID Year Title