Property Summary

NCBI Gene PubMed Count 72
PubMed Score 54.80
PubTator Score 88.42

Knowledge Summary

Patent (4,665)

Synonym

Accession P48039 A0AVC5 B0M0L2 Mel-1A-R
Symbols MT1
MEL-1A-R

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

MLP Assay (15)

AID Type Active / Inconclusive / Inactive Description
1788 other 0 / 0 / 0 Discovery of novel allosteric modulators of the M1 muscarinic receptor: Agonist Ancillary Activity
1921 other 2 / 0 / 0 Discovery of a Highly Selective in vitro and in vivo M4 Positive Allosteric Modulator: Ancillary Activity
624355 other 0 / 0 / 0 Late stage results from the probe development efforts to identify dual inhibitors of signal transducer and activator of transcription 3 (STAT3) and nuclear factor NF-kappa-B (NF-kB): Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
624406 other 0 / 0 / 0 Late stage results from the probe development effort to identify inhibitors of Hepatitis C Virus (HCV) core protein dimerization: Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
652083 other 0 / 0 / 0 Late-stage results from the probe development effort to identify antagonists of OPRK1: CEREP radiometric-based biochemical counterscreen panel assay
686924 other 0 / 0 / 1 ML347 Eurofin Panel Assay for BMP Inhibitor (Probe Compound)
686925 other 0 / 0 / 1 ML352 Eurofin Panel Assay for Choline Transporter Inhibitor (Probe Compound)
686926 other 0 / 0 / 1 ML354 Eurofin Panel Assay for PAR4 Antagonists Inhibitor (Probe Compound)
686927 other 0 / 0 / 1 ML353 Eurofin Panel Assay for mGlu5 SAM Inhibitor (Probe Compound)
743249 screening 1 / 0 / 0 Development of the First Potent, Selective and CNS penetrant M5 Negative Allosteric Modulator (NAM)
More...

Gene RIF (54)

PMID Text
26519818 rs2119882 polymorphism was associated with polycystic ovary syndrome in Han Chinese. A significant difference in transmission of allele C of rs2119882 was found between obese and non-obese women with PCOS.
25822611 Sections from paraffin-embedded normal tissue from 42 individuals, representing the different parts of the GI tract (n=39) and pancreas (n=3) were studied with immunohistochemistry using antibodies for melatonin, MT1 and MT2 receptors and serotonin.
25806809 results support gene-environment interactions of MTNR1A polymorphisms with smoking and betel quid-chewing habits possibly altering oral-cancer susceptibility and metastasis
25514412 There were no significant differences between the expression of MT1 and histological type, staging, grading, presence of residual disease, or overall survival time.
24724723 this study provides a detailed delineation of the melatonin-mediated activation of ERK1/2 in HEK293 cells that are transfected with melatonin receptor MT1.
24157813 genetic polymorphisms rs2119882 in melatonin receptor 1A (MTNR1A) and rs10830963 in melatonin receptor 1B (MTNR1B) are associated with an increased risk of developing gestational diabetes mellitus and insulin resistance in Han Chinese women
24117008 Suggest that physiological regulation of the melatonin receptors may result from complex and subtle mechanisms, a small difference in affinity between the active and inactive states of the receptor, and spontaneous coupling to G-proteins.
23725077 MR-1A placental expression is elevated in all types of hypertensive syndromes in pregnancy
23333399 Genetic inactivation of both transgenic MT1 and MT2 receptors produces an increase of wakefulness, likely as a result of reduced NREMS due to the lack of MT2 transgene receptors, and reduced REMS induced by the lack of MT1 transgene receptors.
23250547 MT1 negative TNBC in all cases regardless of race showed a significantly higher hazard ratio for disease progression, shorter progression free survival, and disease-related death, and shorter OS.
More...

AA Sequence

MQGNGSALPNASQPVLRGDGARPSWLASALACVLIFTIVVDILGNLLVILSVYRNKKLRNAGNIFVVSLA      1 - 70
VADLVVAIYPYPLVLMSIFNNGWNLGYLHCQVSGFLMGLSVIGSIFNITGIAINRYCYICHSLKYDKLYS     71 - 140
SKNSLCYVLLIWLLTLAAVLPNLRAGTLQYDPRIYSCTFAQSVSSAYTIAVVVFHFLVPMIIVIFCYLRI    141 - 210
WILVLQVRQRVKPDRKPKLKPQDFRNFVTMFVVFVLFAICWAPLNFIGLAVASDPASMVPRIPEWLFVAS    211 - 280
YYMAYFNSCLNAIIYGLLNQNFRKEYRRIIVSLCTARVFFVDSSNDVADRVKWKPSPLMTNNNVVKVDSV    281 - 350
//

Text Mined References (72)

PMID Year Title
26519818 2015 Family association study between melatonin receptor gene polymorphisms and polycystic ovary syndrome in Han Chinese.
25967351 2015 The Effects of Melatonin on Brain Arginine Vasotocin: Relationship with Sex and Seasonal Differences in Melatonin Receptor Type 1 in Green Treefrogs (Hyla cinerea).
25833399 2015 Placental melatonin system is present throughout pregnancy and regulates villous trophoblast differentiation.
25822611 2015 Human gastroenteropancreatic expression of melatonin and its receptors MT1 and MT2.
25806809 2015 Interactions between environmental factors and melatonin receptor type 1A polymorphism in relation to oral cancer susceptibility and clinicopathologic development.
25514412 2014 Expression of the MT1 melatonin receptor in ovarian cancer cells.
24724723 2014 Melatonin receptor type 1 signals to extracellular signal-regulated kinase 1 and 2 via Gi and Gs dually coupled pathways in HEK-293 cells.
24157813 2013 Association between genetic variations in MTNR1A and MTNR1B genes and gestational diabetes mellitus in Han Chinese women.
24117008 2014 Melatonin MT? and MT? receptors display different molecular pharmacologies only in the G-protein coupled state.
23725077 2013 Increase of placental sensitivity to melatonin and the alteration to its local synthesis in hypertensive syndromes in pregnancy.
More...