Property Summary

NCBI Gene PubMed Count 584
PubMed Score 3585.17
PubTator Score 2932.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
psoriasis 6694 6.4e-32
osteosarcoma 7950 1.0e-04
tuberculosis 2010 1.7e-04
cutaneous lupus erythematosus 1057 7.7e-03
hepatocellular carcinoma 547 1.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (5)

Disease log2 FC p
cutaneous lupus erythematosus 1.700 7.7e-03
hepatocellular carcinoma 1.200 1.0e-02
osteosarcoma -1.526 1.0e-04
psoriasis 1.200 6.4e-32
tuberculosis -1.500 1.7e-04

Protein-protein Interaction (5)

Gene RIF (595)

AA Sequence

MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPP      1 - 70
LKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEK     71 - 140
KELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHK    141 - 210
VYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYK    211 - 280
L//

Text Mined References (583)

PMID Year Title