Property Summary

NCBI Gene PubMed Count 568
Grant Count 1,214
R01 Count 797
Funding $132,925,654.1
PubMed Score 3494.04
PubTator Score 2932.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
hepatocellular carcinoma 1.200 0.010
cutaneous lupus erythematosus 1.700 0.008
osteosarcoma -1.526 0.000
tuberculosis and treatment for 6 months -1.600 0.000
psoriasis 1.200 0.000

Synonym

Accession P48023 Q9BZP9
Symbols APTL
FASL
CD178
CD95L
ALPS1B
CD95-L
TNFSF6
TNLG1A
APT1LG1

Gene

PDB

1BZI   4MSV   5L19   5L36  

 GO Function (1)

Gene RIF (595)

PMID Text
27117663 FASL, granzyme B, and cytochrome c blood expression reflects breast cancer progression and response to therapy. (Review)
26858129 These results suggested that FAS/FASL polymorphisms might significantly modify SPM risk among patients with SCCHN in a tumor site-specific manner.
26826505 The study identified Fas ligand (FASLG) as the target of let-7e-5p, and FASLG knockdown increased the migration and tube formation of endothelial progenitor cell.
26690594 No mutation or variation could be found in FASL in patients or controls.
26617948 Abnormal Fas/FasL expression in gastric cardia carcinoma and lymph node tissues are involved in carcinogenesis and metastasis of gastric cancer.
26617708 Fas/FasL system and downstream activation of caspases are important mediators of apoptosis and may be involved in the pathogenesis of pulmonary edema in severe P. falciparum malaria patients.
26582200 Data suggest Faim2/LFG (lifeguard protein) protects against FasL-/Fas ligand-induced apoptosis by down-regulating calcium release from endoplasmic reticulum in cortical neurons.
26479732 Advanced glycation end-product induces apoptosis in human retinal cells via promoting mitochondrial dysfunction and activating the Fas-FasL signaling.
26467838 These data indicate that Epstein-Barr virus exosomes derived from EBV-infected cells are taken up by non-infected cells and induce apoptosis via the extrinsic pathway, and that exosomes trigger apoptosis through the FasL pathway.
26429326 No association has been found between FASL promoter polymorphisms and predisposition to HIV infection.
More...

AA Sequence

MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPP      1 - 70
LKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEK     71 - 140
KELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHK    141 - 210
VYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYK    211 - 280
L//

Text Mined References (567)

PMID Year Title
27117663 2016 Apoptosis Markers in Breast Cancer Therapy.
26858129 2016 Site disparities in apoptotic variants as predictors of risk for second primary malignancy in patients with squamous cell carcinoma of the head and neck.
26826505 2016 Downregulation of let-7e-5p contributes to endothelial progenitor cell dysfunction in deep vein thrombosis via targeting FASLG.
26690594 Polymorphisms in FAS and CASP8 genes may contribute to the development of ALPS phenotype: a study in 25 patients with probable ALPS.
26646413 2016 Comparative genomic analysis of eutherian tumor necrosis factor ligand genes.
26617948 2015 Significance of Fas and FasL protein expression in cardiac carcinoma and local lymph node tissues.
26617708 2015 Enhanced expression of Fas and FasL modulates apoptosis in the lungs of severe P. falciparum malaria patients with pulmonary edema.
26582200 2016 Lifeguard Inhibits Fas Ligand-mediated Endoplasmic Reticulum-Calcium Release Mandatory for Apoptosis in Type II Apoptotic Cells.
26479732 2016 Advanced glycation end-product (AGE) induces apoptosis in human retinal ARPE-19 cells via promoting mitochondrial dysfunction and activating the Fas-FasL signaling.
26467838 2015 Epstein-Barr virus-infected cells release Fas ligand in exosomal fractions and induce apoptosis in recipient cells via the extrinsic pathway.
More...