Property Summary

NCBI Gene PubMed Count 48
Grant Count 45
R01 Count 31
Funding $3,196,857.29
PubMed Score 293.94
PubTator Score 107.56

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (36)

PMID Text
26836755 This study defines a Glycosaminoglycan binding surface on XCL1 dimer that includes residues that are important for HIV-1 inhibition.
26134347 Electrostatics and Hydrophobic Effects in the Metamorphic Protein Human Lymphotactin
26085164 XCL1 acts via direct interaction with the external viral envelope glycoprotein, gp120, to block HIV-1 infection
26085164 HIV-1 gp120 interacts with XCL1 electrostatically; the K42R mutation in XCL1 maintained anti-HIV (IIIB and BAL) capacity whilst K42A mutation completely abrogates XCL1 anti-HIV-1 activity
26085164 HIV-1 gp120 interacts with XCL1 electrostatically; the K42R mutation in XCL1 maintained anti-HIV (IIIB and BAL) capacity whilst K42A mutation completely abrogates XCL1 anti-HIV-1 activity
25497737 analysis of XCL1 and XCL2, members of the C-chemokine subfamily, in the immune system
25449536 identified 13 ADCC-activated genes. Six gene expression assays including 8 of the 13 genes (CCL3, CCL4/CCL4L1/CCL4L2, CD160, IFNG, NR4A3 and XCL1/XCL2) were analyzed in 127 kidney biopsies
24899193 HIV-1 gp120 interacts with XCL1 electrostatically; the K42R mutation in XCL1 maintained anti-HIV (IIIB and BAL) capacity whilst K42A mutation completely abrogates XCL1 anti-HIV-1 activity
24899193 HIV-1 gp120 interacts with XCL1 electrostatically; the K42R mutation in XCL1 maintained anti-HIV (IIIB and BAL) capacity whilst K42A mutation completely abrogates XCL1 anti-HIV-1 activity
24385911 XCL1-mediated inhibition is associated with direct interaction of the chemokine with the HIV-1 envelope.
More...

AA Sequence

MRLLILALLGICSLTAYIVEGVGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCA      1 - 70
DPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG                               71 - 114
//

Text Mined References (48)

PMID Year Title
26836755 2016 Examination of Glycosaminoglycan Binding Sites on the XCL1 Dimer.
26134347 2015 Interplay of Electrostatics and Hydrophobic Effects in the Metamorphic Protein Human Lymphotactin.
26085164 2015 Structural Determinants for the Selective Anti-HIV-1 Activity of the All-? Alternative Conformer of XCL1.
25497737 2015 Structural and agonist properties of XCL2, the other member of the C-chemokine subfamily.
25449536 2015 Genes associated with antibody-dependent cell activation are overexpressed in renal biopsies from patients with antibody-mediated rejection.
24385911 2013 The CD8-derived chemokine XCL1/lymphotactin is a conformation-dependent, broad-spectrum inhibitor of HIV-1.
21270681 2012 The chemokines CXCL10 and XCL1 recruit human annulus fibrosus cells.
20541533 2010 Conservation of a chemokine system, XCR1 and its ligand, XCL1, between human and mice.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19797511 2009 Expression and function of the C-class chemokine lymphotactin (XCL1) in Wegener's granulomatosis.
More...