Property Summary

NCBI Gene PubMed Count 50
PubMed Score 310.54
PubTator Score 107.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Synonym

Accession P47992 Q52MA8
Symbols LTN
ATAC
LPTN
SCM1
SCM-1
SCM1A
SCYC1
SCM-1a

Gene

PDB

1J8I   1J9O   2HDM   2JP1   2N54   2NYZ  

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG

 GWAS Trait (1)

Protein-protein Interaction (8)

Gene RIF (34)

AA Sequence

MRLLILALLGICSLTAYIVEGVGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCA      1 - 70
DPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG                               71 - 114
//

Text Mined References (50)

PMID Year Title