Property Summary

NCBI Gene PubMed Count 107
PubMed Score 485.93
PubTator Score 823.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
psoriasis 6685 6.6129935811009E-120
lung carcinoma 2844 8.12838015519692E-27
periodontitis 269 7.78624085445028E-20
Breast cancer 3099 1.1776781142286E-16
lung adenocarcinoma 2714 5.63954377745485E-12
non-small cell lung cancer 2798 1.59134154790704E-10
osteosarcoma 7933 5.64018469489601E-6
ovarian cancer 8492 2.76334764739607E-5
medulloblastoma, large-cell 6234 6.76933080685402E-5
cystic fibrosis 1670 7.1191237759093E-5
pancreatic cancer 2300 2.76832247973412E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 3.29091028188449E-4
ulcerative colitis 2087 6.08682940733272E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00197472107823752
Disease Target Count
Deficiency of xanthine oxidase 1
Disease Target Count
Xanthinuria 1 1

Expression

  Differential Expression (14)

Disease log2 FC p
psoriasis 2.700 0.000
osteosarcoma 1.562 0.000
periodontitis 1.100 0.000
medulloblastoma, large-cell 1.400 0.000
pancreatic ductal adenocarcinoma liver m... -2.028 0.000
non-small cell lung cancer 1.567 0.000
intraductal papillary-mucinous neoplasm ... 4.600 0.002
pancreatic cancer 1.800 0.000
cystic fibrosis 1.700 0.000
lung adenocarcinoma 1.700 0.000
lung carcinoma 1.700 0.000
Breast cancer -3.600 0.000
ulcerative colitis 1.400 0.001
ovarian cancer 2.000 0.000

Synonym

Accession P47989 Q16681 Q16712 Q4PJ16
Symbols XO
XOR
XAN1

Gene

XDH

PANTHER Protein Class (2)

PDB

2CKJ   2E1Q  

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid
Fruitfly OMA Inparanoid

 GWAS Trait (1)

Gene RIF (88)

PMID Text
26863601 XDH and SUCLA2 genes associated with thiopurine-induced leukopenia can act in a complex interactive manner in patients with Crohn's disease.
26426087 beneficial effects observed with XO inhibitors on cardiovascular disease in chronic kidney disease may also be due to the reduction of oxidative stress
26353179 genetic association studies in population in Mexico: Data suggest that SNPs in XO (1936A>G, 2107A>G) are not associated with development of typical adverse reactions to methotrexate in pediatric patients with ALL (acute lymphoblastic leukemia).
26342297 Thyroid stimulating hormone levels are increase in gout patients treated with inhibitors of xanthine oxidoreductase.
26239312 The XDH gene polymorphisms rs1042039, rs1054889, and rs2073316 were shown to be associated with hypertension in a rural Chinese population.
26119820 Data suggest that, with aging, up-regulation of reactive oxygen species derived from XO down-regulates uric acid excretion via down-regulation of active homodimer breast cancer resistance protein (BCRP1, uric acid efflux transporter) in ileal mucosa.
26029922 the essential role of autophagy-regulated early ROS in triggering late apoptotic signaling
25800347 XOR regulated macrophage IL-1b secretion upon NLRP3 inflammasome activation via xanthine oxidase derived reactive oxygen species.
25582077 xanthine oxidase-mediated ROS production is required for PTN-induced cell migration through the cell membrane functional complex of alphanubeta3 and RPTPbeta/zeta and activation of c-src, PI3K and ERK1/2 kinases
25537183 These results supported the possibility that XO/XD and AO can contribute to nitric oxide generation.
More...

AA Sequence

MTADKLVFFVNGRKVVEKNADPETTLLAYLRRKLGLSGTKLGCGEGGCGACTVMLSKYDRLQNKIVHFSA      1 - 70
NACLAPICSLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTMEEIE     71 - 140
NAFQGNLCRCTGYRPILQGFRTFARDGGCCGGDGNNPNCCMNQKKDHSVSLSPSLFKPEEFTPLDPTQEP    141 - 210
IFPPELLRLKDTPRKQLRFEGERVTWIQASTLKELLDLKAQHPDAKLVVGNTEIGIEMKFKNMLFPMIVC    211 - 280
PAWIPELNSVEHGPDGISFGAACPLSIVEKTLVDAVAKLPAQKTEVFRGVLEQLRWFAGKQVKSVASVGG    281 - 350
NIITASPISDLNPVFMASGAKLTLVSRGTRRTVQMDHTFFPGYRKTLLSPEEILLSIEIPYSREGEYFSA    351 - 420
FKQASRREDDIAKVTSGMRVLFKPGTTEVQELALCYGGMANRTISALKTTQRQLSKLWKEELLQDVCAGL    421 - 490
AEELHLPPDAPGGMVDFRCTLTLSFFFKFYLTVLQKLGQENLEDKCGKLDPTFASATLLFQKDPPADVQL    491 - 560
FQEVPKGQSEEDMVGRPLPHLAADMQASGEAVYCDDIPRYENELSLRLVTSTRAHAKIKSIDTSEAKKVP    561 - 630
GFVCFISADDVPGSNITGICNDETVFAKDKVTCVGHIIGAVVADTPEHTQRAAQGVKITYEELPAIITIE    631 - 700
DAIKNNSFYGPELKIEKGDLKKGFSEADNVVSGEIYIGGQEHFYLETHCTIAVPKGEAGEMELFVSTQNT    701 - 770
MKTQSFVAKMLGVPANRIVVRVKRMGGGFGGKETRSTVVSTAVALAAYKTGRPVRCMLDRDEDMLITGGR    771 - 840
HPFLARYKVGFMKTGTVVALEVDHFSNVGNTQDLSQSIMERALFHMDNCYKIPNIRGTGRLCKTNLPSNT    841 - 910
AFRGFGGPQGMLIAECWMSEVAVTCGMPAEEVRRKNLYKEGDLTHFNQKLEGFTLPRCWEECLASSQYHA    911 - 980
RKSEVDKFNKENCWKKRGLCIIPTKFGISFTVPFLNQAGALLHVYTDGSVLLTHGGTEMGQGLHTKMVQV    981 - 1050
ASRALKIPTSKIYISETSTNTVPNTSPTAASVSADLNGQAVYAACQTILKRLEPYKKKNPSGSWEDWVTA   1051 - 1120
AYMDTVSLSATGFYRTPNLGYSFETNSGNPFHYFSYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPA   1121 - 1190
IDIGQVEGAFVQGLGLFTLEELHYSPEGSLHTRGPSTYKIPAFGSIPIEFRVSLLRDCPNKKAIYASKAV   1191 - 1260
GEPPLFLAASIFFAIKDAIRAARAQHTGNNVKELFRLDSPATPEKIRNACVDKFTTLCVTGVPENCKPWS   1261 - 1330
VRV                                                                      1331 - 1333
//

Text Mined References (113)

PMID Year Title
26863601 2016 Influences of XDH genotype by gene-gene interactions with SUCLA2 for thiopurine-induced leukopenia in Korean patients with Crohn's disease.
26426087 2015 Plasma Xanthine Oxidase Activity Is Predictive of Cardiovascular Disease in Patients with Chronic Kidney Disease, Independently of Uric Acid Levels.
26353179 2015 Association of ABCB1, ABCC5 and xanthine oxidase genetic polymorphisms with methotrexate adverse reactions in Mexican pediatric patients with ALL.
26342297 2015 Increase in thyroid stimulating hormone levels in patients with gout treated with inhibitors of xanthine oxidoreductase.
26239312 2015 Association between xanthine dehydrogenase tag single nucleotide polymorphisms and essential hypertension.
26119820 2015 Reactive oxygen species derived from xanthine oxidase interrupt dimerization of breast cancer resistance protein, resulting in suppression of uric acid excretion to the intestinal lumen.
26029922 2015 Autophagy-Regulated ROS from Xanthine Oxidase Acts as an Early Effector for Triggering Late Mitochondria-Dependent Apoptosis in Cathepsin S-Targeted Tumor Cells.
25800347 2015 Xanthine oxidoreductase regulates macrophage IL1? secretion upon NLRP3 inflammasome activation.
25582077 2015 Pleiotrophin-induced endothelial cell migration is regulated by xanthine oxidase-mediated generation of reactive oxygen species.
25537183 2015 Nitrite reductase activity of rat and human xanthine oxidase, xanthine dehydrogenase, and aldehyde oxidase: evaluation of their contribution to NO formation in vivo.
More...