Property Summary

NCBI Gene PubMed Count 20
PubMed Score 231.93
PubTator Score 24.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Myocardial Ischemia 169 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Disease of mental health 36 0.0 1.0

Expression

Gene RIF (7)

AA Sequence

MLSVASRSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFLSRESLSGQAVRRPLVASVGL      1 - 70
NVPASVCYSHTDIKVPDFSEYRRLEVLDSTKSSRESSEARKGFSYLVTGVTTVGVAYAAKNAVTQFVSSM     71 - 140
SASADVLALAKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKEIEQEAAVELSQLRDPQHDLDRVKKPEW    141 - 210
VILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIVG          211 - 274
//

Text Mined References (23)

PMID Year Title