Property Summary

NCBI Gene PubMed Count 28
PubMed Score 200.66
PubTator Score 134.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
active Crohn's disease 3.597 2.2e-03
adrenocortical carcinoma 2.456 6.4e-07
astrocytic glioma -2.600 3.5e-02
Down syndrome -1.500 2.2e-02
ependymoma -2.500 1.8e-06
glioblastoma multiforme -2.300 6.0e-11
interstitial cystitis 1.700 3.7e-03
intraductal papillary-mucinous adenoma (... -2.100 1.4e-03
intraductal papillary-mucinous carcinoma... -2.000 2.7e-03
intraductal papillary-mucinous neoplasm ... -2.000 1.9e-02
lung cancer -1.200 2.8e-03
oligodendroglioma -2.000 1.4e-02
ovarian cancer 1.700 2.6e-03
pancreatic cancer -1.300 6.4e-03
Pick disease -2.300 6.3e-03
pituitary cancer -4.200 1.8e-07
psoriasis -1.300 1.0e-06
sonic hedgehog group medulloblastoma 1.600 7.5e-03
ulcerative colitis 1.700 4.4e-02

Gene RIF (22)

AA Sequence

MLALLAASVALAVAAGAQDSPAPGSRFVCTALPPEAVHAGCPLPAMPMQGGAQSPEEELRAAVLQLRETV      1 - 70
VQQKETLGAQREAIRELTGKLARCEGLAGGKARGAGATGKDTMGDLPRDPGHVVEQLSRSLQTLKDRLES     71 - 140
LEHQLRANVSNAGLPGDFREVLQQRLGELERQLLRKVAELEDEKSLLHNETSAHRQKTESTLNALLQRVT    141 - 210
ELERGNSAFKSPDAFKVSLPLRTNYLYGKIKKTLPELYAFTICLWLRSSASPGIGTPFSYAVPGQANEIV    211 - 280
LIEWGNNPIELLINDKVAQLPLFVSDGKWHHICVTWTTRDGMWEAFQDGEKLGTGENLAPWHPIKPGGVL    281 - 350
ILGQEQDTVGGRFDATQAFVGELSQFNIWDRVLRAQEIVNIANCSTNMPGNIIPWVDNNVDVFGGASKWP    351 - 420
VETCEERLLDL                                                               421 - 431
//

Text Mined References (28)

PMID Year Title