Property Summary

NCBI Gene PubMed Count 25
Grant Count 165
R01 Count 104
Funding $26,596,641.64
PubMed Score 192.30
PubTator Score 134.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Synonym

Accession P47972 A4D267 Q86XV7 Q96G70 NP2
Symbols NP2
NARP
NP-II

Gene

Gene RIF (19)

PMID Text
27083956 Decreased NPTX2 expression in rectal adenocarcinomas is associated with improved response to neoadjuvant chemoradiation and improved prognosis.
26294210 we show that NPTX2 is a marker of poor prognosis for neuroblastoma patients.
24962026 NPTX2 is overexpressed specifically in ccRCC primary tumors.
24078801 NPTX2 repressed NF-kappaB activity by inhibiting AKT through a p53-PTEN-dependent pathway, thus explaining the hypermethylation and downregulation of NPTX2 in NF-kappaB-activated high-risk glioblastomas.
23889936 The visual cortex of NARP-deficient transgenic mice is hyperexcitable and unable to express ocular dominance, although many aspects of visual function are unimpaired.
23624749 Promoter methylation of NPTX2 is associated with glioblastoma.
23360791 Detection of aberrant methylation of NPTX2 in pure pancreatic juice samples could be useful as a molecular marker to discriminate between patients with malignant and benign disease of the pancreas
22806544 This study showed that the NPTX2 protein is down-regulated in human primary pancreatic cancers and in pancreatic cancer cell lines.
22460132 This study demonistrated that childhood-onset mood disorders and suicide attempt association between HOMER1 rs2290639 and between NPTX2 markers rs705315 and rs1681248.
21812817 Demonstrate for the first time that NARP mutation significantly enhances apoptotic death as a result of three distinct lethal mitochondrial apoptotic insults including oxidative, Ca(2+), and lipid stress.
More...

AA Sequence

MLALLAASVALAVAAGAQDSPAPGSRFVCTALPPEAVHAGCPLPAMPMQGGAQSPEEELRAAVLQLRETV      1 - 70
VQQKETLGAQREAIRELTGKLARCEGLAGGKARGAGATGKDTMGDLPRDPGHVVEQLSRSLQTLKDRLES     71 - 140
LEHQLRANVSNAGLPGDFREVLQQRLGELERQLLRKVAELEDEKSLLHNETSAHRQKTESTLNALLQRVT    141 - 210
ELERGNSAFKSPDAFKVSLPLRTNYLYGKIKKTLPELYAFTICLWLRSSASPGIGTPFSYAVPGQANEIV    211 - 280
LIEWGNNPIELLINDKVAQLPLFVSDGKWHHICVTWTTRDGMWEAFQDGEKLGTGENLAPWHPIKPGGVL    281 - 350
ILGQEQDTVGGRFDATQAFVGELSQFNIWDRVLRAQEIVNIANCSTNMPGNIIPWVDNNVDVFGGASKWP    351 - 420
VETCEERLLDL                                                               421 - 431
//

Text Mined References (25)

PMID Year Title
27083956 2016 NPTX2 is associated with neoadjuvant therapy response in rectal cancer.
26294210 2015 The Neuronal Pentraxin-2 Pathway Is an Unrecognized Target in Human Neuroblastoma, Which Also Offers Prognostic Value in Patients.
24962026 2014 Neuronal pentraxin 2 supports clear cell renal cell carcinoma by activating the AMPA-selective glutamate receptor-4.
24078801 2013 A DNA methylation prognostic signature of glioblastoma: identification of NPTX2-PTEN-NF-?B nexus.
23889936 2013 Obligatory role for the immediate early gene NARP in critical period plasticity.
23624749 2013 Promoter methylation of AREG, HOXA11, hMLH1, NDRG2, NPTX2 and Tes genes in glioblastoma.
23360791 2013 NPTX2 hypermethylation in pure pancreatic juice predicts pancreatic neoplasms.
22806544 2012 Neuronal pentraxin II (NPTX2) is frequently down-regulated by promoter hypermethylation in pancreatic cancers.
22460132 2012 Association study of early-immediate genes in childhood-onset mood disorders and suicide attempt.
21812817 2012 mtDNA T8993G mutation-induced mitochondrial complex V inhibition augments cardiolipin-dependent alterations in mitochondrial dynamics during oxidative, Ca(2+), and lipid insults in NARP cybrids: a potential therapeutic target for melatonin.
More...