Property Summary

NCBI Gene PubMed Count 7
Grant Count 3
R01 Count 3
Funding $181,095.75
PubMed Score 34.86
PubTator Score 185.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Gene RIF (5)

PMID Text
20634891 Observational study of gene-disease association. (HuGE Navigator)
19921116 The association of metallothionein-4 gene polymorphism and renal function in long-term lead-exposed workers
19921116 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19515364 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
12539042 Microarray analysis indicates HIV-1 Tat upregulates the interferon-responsive gene expression of many proteins, including Metallothionein, in immature dendritic cells, an effect that likely facilitates the expansion of HIV-1 infection

AA Sequence

MDPRECVCMSGGICMCGDNCKCTTCNCKTYWKSCCPCCPPGCAKCARGCICKGGSDKCSCCP              1 - 62
//

Text Mined References (8)

PMID Year Title
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
19921116 2010 The association of metallothionein-4 gene polymorphism and renal function in long-term lead-exposed workers.
19515364 2009 Genetic background of lead and mercury metabolism in a group of medical students in Austria.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12539042 2003 HIV-1 Tat reprograms immature dendritic cells to express chemoattractants for activated T cells and macrophages.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8003488 1994 Induction of a new metallothionein isoform (MT-IV) occurs during differentiation of stratified squamous epithelia.