Property Summary

NCBI Gene PubMed Count 13
PubMed Score 614.10
PubTator Score 10.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Influenza 142 5.728 2.9
Cancer 2499 4.127 2.1

Expression

Synonym

Accession P47929 Q6IB87 Gal-7
Symbols PI7
GAL7
Gal-7
HKL-14
LGALS7

Gene

PANTHER Protein Class (1)

PDB

1BKZ   2GAL   3GAL   3ZXE   3ZXF   4GAL   4UW3   4UW4   4UW5   4UW6   4XBQ   4Y26   5GAL   5H9Q   5H9S  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSW      1 - 70
GREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF         71 - 136
//

Text Mined References (13)

PMID Year Title