Property Summary

NCBI Gene PubMed Count 13
Grant Count 142
R01 Count 62
Funding $20,528,173.8
PubMed Score 603.39
PubTator Score 10.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

Synonym

Accession P47929 Q6IB87 Gal-7
Symbols PI7
GAL7
Gal-7
HKL-14
LGALS7

Gene

PANTHER Protein Class (1)

PDB

1BKZ   2GAL   3GAL   3ZXE   3ZXF   4GAL   4UW3   4UW4   4UW5   4UW6   4XBQ   4Y26   5GAL   5H9Q   5H9S  

Gene RIF (2)

PMID Text
24534543 serum concentration was significantly elevated in women (weeks 10-12 and 17-20) who subsequently developed pre-eclampsia
18315601 An association was seen between the level of presence of galectins-1 and -7 and neoplastic progression of hypopharyngeal and laryngeal squamous cell carcinomas.

AA Sequence

MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSW      1 - 70
GREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF         71 - 136
//

Text Mined References (13)

PMID Year Title
24534543 2014 Galectin-7 serum levels are altered prior to the onset of pre-eclampsia.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
18315601 2008 Increased expression and altered intracellular distribution of adhesion/growth-regulatory lectins galectins-1 and -7 during tumour progression in hypopharyngeal and laryngeal squamous cell carcinomas.
16788763 2006 Galectin 7 (p53-induced gene 1): a new prognostic predictor of recurrence and survival in stage IV hypopharyngeal cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
13679866 2003 Homodimeric galectin-7 (p53-induced gene 1) is a negative growth regulator for human neuroblastoma cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11706006 2002 Galectin-7 (PIG1) exhibits pro-apoptotic function through JNK activation and mitochondrial cytochrome c release.
More...