Property Summary

NCBI Gene PubMed Count 71
PubMed Score 165.60
PubTator Score 118.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
breast carcinoma 1614 1.51014188697317E-46
non-small cell lung cancer 2798 8.28157817437381E-29
Breast cancer 3099 2.08118288385708E-27
glioblastoma multiforme 347 7.89974757023935E-16
psoriasis 6685 4.87445325648502E-9
cystic fibrosis 1670 3.26299159123243E-8
malignant mesothelioma 3163 2.08392037017565E-7
lung adenocarcinoma 2714 7.54605321398049E-6
intraductal papillary-mucinous adenoma (IPMA) 2956 6.27516111502176E-5
group 4 medulloblastoma 1875 6.97551369425013E-5
medulloblastoma, large-cell 6234 7.32607802299271E-5
pilocytic astrocytoma 3086 1.23368708294353E-4
Atopic dermatitis 944 1.79892928998858E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 5.26015417600536E-4
Down syndrome 548 6.91420884256988E-4
ovarian cancer 8492 9.37105875248353E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 9.40435724391326E-4
invasive ductal carcinoma 2950 0.00106227209062719
adult high grade glioma 2148 0.00205192271498366
cutaneous lupus erythematosus 1056 0.00247837354773726
pituitary cancer 1972 0.00330365211731888
interstitial cystitis 2299 0.00333635785548435
primary pancreatic ductal adenocarcinoma 1271 0.0041621721836493
osteosarcoma 7933 0.00444222107830658
ependymoma 2514 0.0106585035287169
ductal carcinoma in situ 1745 0.011037259015587
astrocytic glioma 2241 0.0159201310295268
active Crohn's disease 918 0.0177765776678879
oligodendroglioma 2849 0.0197262892008698
non primary Sjogren syndrome sicca 840 0.0216947777080044
active ulcerative colitis 477 0.0219280106321797
Disease Target Count Z-score Confidence
Cancer 2346 3.916 2.0

Expression

Synonym

Accession P47928 Q13005
Symbols IDB4
bHLHb27

Gene

ID4

PANTHER Protein Class (1)

  Ortholog (8)

 GO Component (2)

 GWAS Trait (1)

Gene RIF (57)

PMID Text
26648013 Hypermethylation of ID4 promotes the proliferation of Burkitt's lymphoma cells; ID4 may function as a tumor suppressor and can be targeted with demethylating compounds such as CdR for the treatment of Burkitt's lymphoma
26610810 the unmethylation of ID4 is an epigenetic predictor of BRCAness phenotype in breast tumors.
26464711 ID4 hypomethylation is present in tamoxifen-resistant breast cancer, and it may serve as a potential biomarker in distinguishing tamoxifen-resistant breast cancer.
26228212 The results showed that the detection of ID4 methylation positivity rates and levels could be a useful biomarker for MDS diagnosis.
26032025 The chromosomal deletion 6p22.3 could result in the aberrant activation and mis-expression of ID4 in the limb bud, thereby causing mesomelic dysplasia Savarirayan type.
25889027 Myelodysplastic syndrome patients with ID4 methylation had shorter survival time than those without ID4 methylation .
25813983 ID4 marks a stem cell-enriched subset of the mammary basal cell population. ID4 is specifically expressed by a subset of human basal-like breast cancer that possess a very poor prognosis and a transcriptional signature similar to a mammary stem cell.
25778840 Inhibitor of differentiation 4 (ID4) acts as an inhibitor of ID-1, -2 and -3 and promotes basic helix loop helix (bHLH) E47 DNA binding and transcriptional activity.
25684485 Increased hypermethylation of ID4 is associated with Triple negative breast cancer.
25642713 Inhibitor of DNA Binding 4 (ID4) is highly expressed in human melanoma tissues and may function to restrict normal differentiation of melanoma cells
More...

AA Sequence

MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMND      1 - 70
CYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPPPAPPHHPAGTCPAAPPRTPL     71 - 140
TALNTDPAGAVNKQGDSILCR                                                     141 - 161
//

Text Mined References (71)

PMID Year Title
26648013 2016 Inhibitor of DNA binding 4 functions as a tumor suppressor and is targetable by 5-aza-2'-deoxycytosine with potential therapeutic significance in Burkitt's lymphoma.
26610810 2016 Epigenetic regulation of ID4 in the determination of the BRCAness phenotype in breast cancer.
26464711 2015 Hypomethylation of DNA-binding inhibitor 4 serves as a potential biomarker in distinguishing acquired tamoxifen-refractory breast cancer.
26228212 2015 Quantitative Detection of ID4 Gene Aberrant Methylation in the Differentiation of Myelodysplastic Syndrome from Aplastic Anemia.
26032025 2015 Microdeletions on 6p22.3 are associated with mesomelic dysplasia Savarirayan type.
25889027 2015 Clinical implications of the quantitative detection of ID4 gene methylation in myelodysplastic syndrome.
25813983 2015 ID4 controls mammary stem cells and marks breast cancers with a stem cell-like phenotype.
25778840 2015 Inhibitor of differentiation 4 (ID4) acts as an inhibitor of ID-1, -2 and -3 and promotes basic helix loop helix (bHLH) E47 DNA binding and transcriptional activity.
25684485 2015 Increased hypermethylation of glutathione S-transferase P1, DNA-binding protein inhibitor, death associated protein kinase and paired box protein-5 genes in triple-negative breast cancer Saudi females.
25642713 2015 Inhibitor of DNA Binding 4 (ID4) is highly expressed in human melanoma tissues and may function to restrict normal differentiation of melanoma cells.
More...