Property Summary

NCBI Gene PubMed Count 81
PubMed Score 177.27
PubTator Score 118.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Animal Mammary Neoplasms 136
Disease Target Count Z-score Confidence
Cancer 2499 3.929 2.0
Retinitis pigmentosa 58 13 3.561 1.8

Expression

  Differential Expression (31)

Disease log2 FC p
active Crohn's disease -1.113 1.8e-02
active ulcerative colitis -2.235 2.2e-02
adult high grade glioma 1.100 5.7e-04
astrocytic glioma 2.800 7.7e-03
Astrocytoma, Pilocytic 1.200 8.3e-06
Atopic dermatitis -1.500 1.8e-04
Breast cancer -4.800 4.5e-17
breast carcinoma -2.100 1.2e-05
cutaneous lupus erythematosus -2.200 2.5e-03
cystic fibrosis -4.149 3.3e-08
Down syndrome 2.000 6.9e-04
ductal carcinoma in situ -1.600 9.5e-03
ependymoma 2.700 8.2e-03
glioblastoma multiforme 1.400 7.9e-16
group 3 medulloblastoma -1.700 6.3e-04
interstitial cystitis -1.500 2.4e-03
intraductal papillary-mucinous adenoma (... -4.500 6.3e-05
intraductal papillary-mucinous carcinoma... -5.000 9.4e-04
intraductal papillary-mucinous neoplasm ... -3.900 5.3e-04
invasive ductal carcinoma -3.500 3.6e-03
lung adenocarcinoma -1.100 1.1e-15
malignant mesothelioma 3.500 2.1e-07
medulloblastoma, large-cell -3.300 7.3e-05
non primary Sjogren syndrome sicca 1.400 2.2e-02
non-small cell lung cancer -2.232 1.9e-18
oligodendroglioma 2.000 1.5e-02
osteosarcoma 1.569 4.4e-03
ovarian cancer -1.600 1.8e-02
pituitary cancer -3.100 3.3e-03
primary pancreatic ductal adenocarcinoma -1.148 4.2e-03
psoriasis -1.700 6.1e-08

 GO Component (2)

Gene RIF (66)

AA Sequence

MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMND      1 - 70
CYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPPPAPPHHPAGTCPAAPPRTPL     71 - 140
TALNTDPAGAVNKQGDSILCR                                                     141 - 161
//

Text Mined References (81)

PMID Year Title