Property Summary

NCBI Gene PubMed Count 32
Grant Count 5
Funding $884,979
PubMed Score 73.99
PubTator Score 11023.63

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P47914 A8K0H3 B2R4M8 Q6IPY3
Symbols HIP
L29
HUMRPL29
RPL29P10
RPL29_3_370

Gene

PDB

4UG0   4V6X   5AJ0  

Gene RIF (13)

PMID Text
26362536 HIV-1 Gag interacts with RPL29 as demonstrated by proximity dependent biotinylation proteomics
23874603 HIV-1 Gag interacts with RPL29 as demonstrated by proximity dependent biotinylation proteomics
23125841 HIV-1 Gag interacts with RPL29 as demonstrated by proximity dependent biotinylation proteomics
23125841 HIV-1 Gag interacts with RPL29 as demonstrated by proximity dependent biotinylation proteomics
23125841 HIV-1 Gag interacts with RPL29 as demonstrated by proximity dependent biotinylation proteomics
23125841 HIV-1 Gag interacts with RPL29 as demonstrated by proximity dependent biotinylation proteomics
22868929 The results showed that knockdown of RPL26 or RPL29 expression significantly suppressed cell proliferation, induced cell arrest at G0/G1 phase and enhanced cell apoptosis
20554519 Knockdown of L29 or L30 enhanced the interaction of MDM2 with L11 and L5 and markedly inhibited MDM2-mediated p53 ubiquitination, suggesting that direct perturbation of 60 S ribosomal biogenesis activates p53 via L11- and L5-mediated MDM2 suppression.
18980226 HIP/RPL29 antagonizes VEGF and FGF2 stimulated angiogenesis by interfering with HS-dependent responses
17620340 Hip is a pro-survival substrate of granzyme B
More...

AA Sequence

MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKMQANNAKAMSARAE      1 - 70
AIKALVKPKEVKPKIPKGVSRKLDRLAYIAHPKLGKRARARIAKGLRLCRPKAKAKAKAKDQTKAQAAAP     71 - 140
ASVPAQAPKRTQAPTKASE                                                       141 - 159
//

Text Mined References (42)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22868929 2012 Silencing expression of ribosomal protein L26 and L29 by RNA interfering inhibits proliferation of human pancreatic cancer PANC-1 cells.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
More...