Property Summary

NCBI Gene PubMed Count 32
PubMed Score 77.02
PubTator Score 11023.63

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

AA Sequence

MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKMQANNAKAMSARAE      1 - 70
AIKALVKPKEVKPKIPKGVSRKLDRLAYIAHPKLGKRARARIAKGLRLCRPKAKAKAKAKDQTKAQAAAP     71 - 140
ASVPAQAPKRTQAPTKASE                                                       141 - 159
//

Text Mined References (43)

PMID Year Title