Property Summary

NCBI Gene PubMed Count 42
PubMed Score 94.82
PubTator Score 66.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 6.4e-07
psoriasis 6694 1.9e-02
Disease Target Count Z-score Confidence
Cancer 2499 3.662 1.8
Bile reflux 9 3.53 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.955 6.4e-07
psoriasis 1.100 1.9e-02

Gene RIF (34)

AA Sequence

MYVGYVLDKDSPVYPGPARPASLGLGPQAYGPPAPPPAPPQYPDFSSYSHVEPAPAPPTAWGAPFPAPKD      1 - 70
DWAAAYGPGPAAPAASPASLAFGPPPDFSPVPAPPGPGPGLLAQPLGGPGTPSSPGAQRPTPYEWMRRSV     71 - 140
AAGGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKER    141 - 210
KVNKKKQQQQQPPQPPMAHDITATPAGPSLGGLCPSNTSLLATSSPMPVKEEFLP                   211 - 265
//

Text Mined References (42)

PMID Year Title