Property Summary

NCBI Gene PubMed Count 40
Grant Count 45
R01 Count 35
Funding $3,955,099.33
PubMed Score 92.38
PubTator Score 66.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.100 0.019
osteosarcoma 1.955 0.000

Gene RIF (32)

PMID Text
26841784 Changes in CDX1/CDX2 mRNA expression in gastric mucosa following H. pylori eradication showed only insignificant results
26537799 Data indicate an association between highly fucosylated glycans and caudal type homeobox 1 (CDX1) and/or villin mRNA expression that both correlate with cell differentiation.
25775580 miR-215 is a link between CDX1 expression and BMI1 repression that governs differentiation in colorectal cancer
24836459 CDX1 restricts the invasion of HTR-8/SVneo trophoblast cells by inhibiting MMP-9 expression independently of the PI3K/AKT pathway.
23918153 Certain SNPs of Cdx1 and Cdx2 and their interactions with other risk factors are associated with Barrett's esophagus (BE) and may contribute to human susceptibility to BE.
23624503 Data indicate that autophagy is activated though the Cdx1-Bcl-2-LC3 pathway.
23618814 Oxidative stress regulates CDX1 expression in T84 colorectal cancer cells.
23613102 The differential regulation of the gene expression of CDX1, CDX2 and SOX2 in patients with gastric cancer affects not only the tumour but also the non-neoplastic tumour-distant mucosa.
23353818 Results showed an anti-growth effect of CDX1 and identified its miRNA regulatory mechanism in gastric cancer.
23329892 The findings represented the relation between CDX1 mutations and CDX1 genotype. Furthermore, it was suggested that the downregulation of CDX1 might be related to the development of Anorectal malformations .
More...

AA Sequence

MYVGYVLDKDSPVYPGPARPASLGLGPQAYGPPAPPPAPPQYPDFSSYSHVEPAPAPPTAWGAPFPAPKD      1 - 70
DWAAAYGPGPAAPAASPASLAFGPPPDFSPVPAPPGPGPGLLAQPLGGPGTPSSPGAQRPTPYEWMRRSV     71 - 140
AAGGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKER    141 - 210
KVNKKKQQQQQPPQPPMAHDITATPAGPSLGGLCPSNTSLLATSSPMPVKEEFLP                   211 - 265
//

Text Mined References (40)

PMID Year Title
26841784 2016 Follow-Up Study on CDX1 and CDX2 mRNA Expression in Noncancerous Gastric Mucosae After Helicobacter pylori Eradication.
26537799 2016 N-glycosylation Profiling of Colorectal Cancer Cell Lines Reveals Association of Fucosylation with Differentiation and Caudal Type Homebox 1 (CDX1)/Villin mRNA Expression.
26412852 2015 Comprehensive comparative homeobox gene annotation in human and mouse.
25775580 2015 The CDX1-microRNA-215 axis regulates colorectal cancer stem cell differentiation.
24836459 2014 CDX1 restricts the invasion of HTR-8/SVneo trophoblast cells by inhibiting MMP-9 expression.
24623306 2014 A KRAS-directed transcriptional silencing pathway that mediates the CpG island methylator phenotype.
23918153 2014 Single nucleotide polymorphisms of caudal type homeobox 1 and 2 are associated with Barrett's esophagus.
23624503 2013 Autophagy of cancer stem cells is involved with chemoresistance of colon cancer cells.
23618814 2013 Oxidative stress causes epigenetic alteration of CDX1 expression in colorectal cancer cells.
23613102 2013 Dysregulation of CDX1, CDX2 and SOX2 in patients with gastric cancer also affects the non-malignant mucosa.
More...