Property Summary

NCBI Gene PubMed Count 39
Grant Count 11
Funding $4,150,744.79
PubMed Score 52.66
PubTator Score 32.17

Knowledge Summary

Patent (1,173)

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.700 0.000
osteosarcoma 1.917 0.000

MLP Assay (5)

AID Type Active / Inconclusive / Inactive Description
2570 confirmatory 0 / 5 / 83 Counterscreen Concentration-Response Assay for Antagonists of the Neuropeptide S Receptor: Vasopressin Receptor Calcium Signal Transduction
434974 screening 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen
492948 confirmatory 201 / 189 / 79 qHTS Assay for Agonists of the Relaxin Receptor RXFP1: V1B Hit Validation
602262 confirmatory 1 / 0 / 66 qHTS Assay for Agonists of the Relaxin Receptor RXFP1: V1B SAR
743056 confirmatory 6 / 0 / 25 Late-stage results from the probe development effort to identify antagonists of arginine vasopressin receptor 1a (AVPR1a): fluorescence-based cell-based dose response AVPR1b inhibition counterscreen assay

Gene RIF (29)

PMID Text
26503846 Genetic variance of arginine vasopressin receptor 1B(AVPR1B) contributes to overweight and data indicate a link between AVPR1B variance and diabetes mellitus development
26354157 The results suggest that the AVPR1B gene rs28373064 is linked to emotional empathy and prosociality.
25438555 The association of AVPR1B G*A-haplotype (rs28632197 and rs33911258, respectively) and decreased Self-transcendence (TCI-125) was demonstrated in the total sample and in Udmurts.
25309987 Participants carrying both GG/GA variant of AVPR1b rs28373064 and AA variant of clock rs6832769 showed highest scores on the Emotional prosocial tendency measure. the clock gene and OXT/AVP systems are intertwined and contribute to human prosociality.
24919159 AA genotype of rs28418396 single-nucleotide polymorphism near the arginine vasopressin receptor 1b gene is associated with serious adverse events in patients with septic shock treated with vasopressin and norepinephrine.
24842238 The associations of the AVP 1B receptor may be specific to reactive, emotional rather than proactive or callous types of aggression.
24012103 association between polymorphisms of AVPR1b gene and psychotic dimension.possible involvement of the AVPR1b gene in the etiology of psychotic features in the course of affective disorders
23962971 Polymorphisms of CRHR1 and AVPR1b may modify susceptibility to mood disorders.
23422793 AVPR1B genetic variation has a role in suicide attempt etiology characterized by elevated depression levels.
23068076 The results of thi study showed that no association was found for alleles, genotypes, or haplotype analysis for AVPR1b genes and melancholic depression.
More...

AA Sequence

MDSGPLWDANPTPRGTLSAPNATTPWLGRDEELAKVEIGVLATVLVLATGGNLAVLLTLGQLGRKRSRMH      1 - 70
LFVLHLALTDLAVALFQVLPQLLWDITYRFQGPDLLCRAVKYLQVLSMFASTYMLLAMTLDRYLAVCHPL     71 - 140
RSLQQPGQSTYLLIAAPWLLAAIFSLPQVFIFSLREVIQGSGVLDCWADFGFPWGPRAYLTWTTLAIFVL    141 - 210
PVTMLTACYSLICHEICKNLKVKTQAWRVGGGGWRTWDRPSPSTLAATTRGLPSRVSSINTISRAKIRTV    211 - 280
KMTFVIVLAYIACWAPFFSVQMWSVWDKNAPDEDSTNVAFTISMLLGNLNSCCNPWIYMGFNSHLLPRPL    281 - 350
RHLACCGGPQPRMRRRLSDGSLSSRHTTLLTRSSCPATLSLSLSLTLSGRPRPEESPRDLELADGEGTAE    351 - 420
TIIF                                                                      421 - 424
//

Text Mined References (39)

PMID Year Title
26503846 2016 Genetic vasopressin 1b receptor variance in overweight and diabetes mellitus.
26354157 2015 The arginine vasopressin V1b receptor gene and prosociality: Mediation role of emotional empathy.
25438555 2014 [Arginine-vasopressin receptor gene (AVPR1A, AVPR1B) polymorphisms and their relation to personality traits].
25309987 2014 Clock gene modulates roles of OXTR and AVPR1b genes in prosociality.
24919159 2014 Serious adverse events associated with vasopressin and norepinephrine infusion in septic shock.
24842238 2014 Association between a polymorphism of the vasopressin 1B receptor gene and aggression in children.
24012103 2013 Association between OPCRIT dimensions and polymorphisms of HPA axis genes in bipolar disorder.
23962971 2013 Epistatic interaction between CRHR1 and AVPR1b variants as a predictor of major depressive disorder.
23422793 2013 Family-based study of AVPR1B association and interaction with stressful life events on depression and anxiety in suicide attempts.
23068076 2013 No association between polymorphisms and haplotypes of the AVPR1b, CRHR1 and NR3C1 genes and depression with melancholic features in the course of bipolar disorder.
More...