Property Summary

Ligand Count 101
NCBI Gene PubMed Count 39
PubMed Score 59.30
PubTator Score 32.17

Knowledge Summary

Patent (1,173)

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.917 1.1e-07
psoriasis 1.700 2.2e-04

Protein-protein Interaction (1)

Gene RIF (29)

AA Sequence

MDSGPLWDANPTPRGTLSAPNATTPWLGRDEELAKVEIGVLATVLVLATGGNLAVLLTLGQLGRKRSRMH      1 - 70
LFVLHLALTDLAVALFQVLPQLLWDITYRFQGPDLLCRAVKYLQVLSMFASTYMLLAMTLDRYLAVCHPL     71 - 140
RSLQQPGQSTYLLIAAPWLLAAIFSLPQVFIFSLREVIQGSGVLDCWADFGFPWGPRAYLTWTTLAIFVL    141 - 210
PVTMLTACYSLICHEICKNLKVKTQAWRVGGGGWRTWDRPSPSTLAATTRGLPSRVSSINTISRAKIRTV    211 - 280
KMTFVIVLAYIACWAPFFSVQMWSVWDKNAPDEDSTNVAFTISMLLGNLNSCCNPWIYMGFNSHLLPRPL    281 - 350
RHLACCGGPQPRMRRRLSDGSLSSRHTTLLTRSSCPATLSLSLSLTLSGRPRPEESPRDLELADGEGTAE    351 - 420
TIIF                                                                      421 - 424
//

Text Mined References (39)

PMID Year Title