Property Summary

Ligand Count 198
NCBI Gene PubMed Count 102
PubMed Score 345.64
PubTator Score 353.56

Knowledge Summary

Patent (20,833)

Expression

  Differential Expression (20)

Disease log2 FC p
active ulcerative colitis -1.782 2.6e-02
acute quadriplegic myopathy -1.306 7.2e-04
adult high grade glioma 1.600 3.7e-03
atypical teratoid / rhabdoid tumor -1.500 4.4e-02
colon cancer -2.500 1.7e-03
ependymoma 1.100 4.7e-04
glioblastoma 1.200 2.1e-03
group 4 medulloblastoma -2.500 2.1e-04
interstitial cystitis -1.300 1.7e-04
intraductal papillary-mucinous adenoma (... -2.400 2.6e-03
intraductal papillary-mucinous carcinoma... -2.700 3.2e-03
lung adenocarcinoma -1.800 1.7e-18
medulloblastoma, large-cell -1.600 7.5e-04
nasopharyngeal carcinoma -1.500 8.4e-03
osteosarcoma 1.904 3.3e-02
ovarian cancer -2.300 3.6e-07
Rheumatoid arthritis 1.700 3.6e-02
spina bifida -1.409 4.1e-02
subependymal giant cell astrocytoma 1.938 3.2e-02
tuberculosis -1.200 4.8e-06

 GWAS Trait (1)

Protein-protein Interaction (6)

Gene RIF (86)

AA Sequence

MTEVLWPAVPNGTDAAFLAGPGSSWGNSTVASTAAVSSSFKCALTKTGFQFYYLPAVYILVFIIGFLGNS      1 - 70
VAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFGDAMCKLQRFIFHVNLYGSIL     71 - 140
FLTCISAHRYSGVVYPLKSLGRLKKKNAICISVLVWLIVVVAISPILFYSGTGVRKNKTITCYDTTSDEY    141 - 210
LRSYFIYSMCTTVAMFCVPLVLILGCYGLIVRALIYKDLDNSPLRRKSIYLVIIVLTVFAVSYIPFHVMK    211 - 280
TMNLRARLDFQTPAMCAFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANL    281 - 350
QSKSEDMTLNILPEFKQNGDTSL                                                   351 - 373
//

Text Mined References (103)

PMID Year Title