Property Summary

NCBI Gene PubMed Count 94
Grant Count 133
R01 Count 81
Funding $11,498,001.65
PubMed Score 334.28
PubTator Score 353.56

Knowledge Summary

Patent (20,833)

Expression

Synonym

Accession P47900 P2Y1
Symbols P2Y1

Gene

PANTHER Protein Class (2)

PDB

1Y36   4XNV   4XNW  

  TechDev Info (1)

Gene RIF (78)

PMID Text
26743169 Synergistic inhibition of both P2Y1 and P2Y12 adenosine diphosphate receptors by GLS-409 immediately attenuates platelet-mediated thrombosis and effectively blocks agonist-stimulated platelet aggregation irrespective of concomitant aspirin therapy.
26475857 P2Y1 couples to and activates TRPV4. PKC inhibitors prevented P2Y1 receptor activation of TRPV4.
25937122 Data indicate that ATP-evoked Hoechst 33258 uptake was dependent on activation of P2Y receptors P2Y1 and P2Y2.
25822790 crystal structures of the human P2Y1R in complex with a nucleotide antagonist MRS2500 at 2.7 A resolution, and with a non-nucleotide antagonist BPTU at 2.2 A resolution
25593131 Antibody EL2Ab binds to and exhibits P2Y1R-dependent function-blocking activity in the context of platelets.
25351961 Interaction of the HIV-1 gp120 with macrophages triggers an increase in ATP release that stimulates purinergic receptor P2X(1), P2X(7), and P2Y(1) proteins and facilitates HIV entry and subsequent stages of viral replication
25341729 This study shows that Up4A is a potent native agonist for P2Y1R and SK-channel activation in human and mouse colon.
25003238 The immunohistochemical results were reflected in the immunoblotting data P2RY1 receptors were detected at higher levels of expression in patient with cortical dysplasia with intractable epilepsy.
24998877 P2Y1 receptors are a potential pharmacological target leading smooth muscle relaxation to treat spasticity in colonic motor disorders.
24829920 These studies demonstrate a role for P2Y receptor activation in stimulation of ATP release.
More...

AA Sequence

MTEVLWPAVPNGTDAAFLAGPGSSWGNSTVASTAAVSSSFKCALTKTGFQFYYLPAVYILVFIIGFLGNS      1 - 70
VAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFGDAMCKLQRFIFHVNLYGSIL     71 - 140
FLTCISAHRYSGVVYPLKSLGRLKKKNAICISVLVWLIVVVAISPILFYSGTGVRKNKTITCYDTTSDEY    141 - 210
LRSYFIYSMCTTVAMFCVPLVLILGCYGLIVRALIYKDLDNSPLRRKSIYLVIIVLTVFAVSYIPFHVMK    211 - 280
TMNLRARLDFQTPAMCAFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANL    281 - 350
QSKSEDMTLNILPEFKQNGDTSL                                                   351 - 373
//

Text Mined References (95)

PMID Year Title
26743169 2016 Synergistic Inhibition of Both P2Y1 and P2Y12 Adenosine Diphosphate Receptors As Novel Approach to Rapidly Attenuate Platelet-Mediated Thrombosis.
26475857 2015 P2Y1 Receptor Activation of the TRPV4 Ion Channel Enhances Purinergic Signaling in Satellite Glial Cells.
25937122 2015 Selective permeabilization of cervical cancer cells to an ionic DNA-binding cytotoxin by activation of P2Y receptors.
25822790 2015 Two disparate ligand-binding sites in the human P2Y1 receptor.
25593131 2015 Characterization of a novel function-blocking antibody targeted against the platelet P2Y1 receptor.
25341729 2014 Uridine adenosine tetraphosphate is a novel neurogenic P2Y1 receptor activator in the gut.
25003238 2014 Expression of astrocyte-related receptors in cortical dysplasia with intractable epilepsy.
24998877 2014 ?,?-meATP mimics the effects of the purinergic neurotransmitter in the human and rat colon.
24829920 2014 P2Y receptor modulation of ATP release in the urothelium.
24524250 2014 Alanine-(87)-threonine polymorphism impairs signaling and internalization of the human P2Y11 receptor, when co-expressed with the P2Y1 receptor.
More...