Property Summary

NCBI Gene PubMed Count 39
Grant Count 7
Funding $363,718.51
PubMed Score 48.37
PubTator Score 58.38

Knowledge Summary

Patent (2,965)

MLP Assay (11)

AID Type Active / Inconclusive / Inactive Description
504634 screening 279 / 0 / 335182 Counterscreen for inverse agonists of OPRM1-OPRD1 heterodimerization: luminescence-based cell-based full-deck high throughput screening assay to identify inverse agonists of 5-hydroxytryptamine (serotonin) 5A receptor (HTR5A)
504692 screening 2039 / 0 / 333422 Counterscreen for agonists of OPRM1-OPRD1 heterodimerization: luminescence-based cell-based full-deck high throughput screening assay to identify agonists of 5-hydroxytryptamine (serotonin) 5A receptor (HTR5A)
504905 screening 65 / 0 / 769 Counterscreen for agonists of OPRM1-OPRD1 heterodimerization: luminescence-based cell-based high throughput screening assay to identify agonists of 5-hydroxytryptamine (serotonin) 5A receptor (HTR5A)
504913 screening 108 / 0 / 696 Counterscreen for agonists of 5-hydroxytryptamine (serotonin) 5A receptor (HTR5A): luminescence-based cell-based high throughput screening assay to identify agonists of OPRM1-OPRD1 heterodimerization
504914 screening 4 / 0 / 576 Counterscreen for inverse agonists of OPRM1-OPRD1 heterodimerization: luminescence-based cell-based high throughput screening assay to identify inverse agonists of 5-hydroxytryptamine (serotonin) 5A receptor (HTR5A)
504915 screening 134 / 0 / 670 Luminescence-based cell-based high throughput confirmation assay for agonists of 5-hydroxytryptamine (serotonin) 5A receptor (HTR5A)
504916 screening 6 / 0 / 186 Luminescence-based cell-based high throughput confirmation assay for inverse agonists of 5-hydroxytryptamine (serotonin) 5A receptor (HTR5A)
588408 confirmatory 0 / 0 / 229 Counterscreen for agonists of OPRM1-OPRD1 heterodimerization: luminescence-based cell-based high throughput dose response assay to identify agonists of 5-hydroxytryptamine (serotonin) 5A receptor (HTR5A)
651688 confirmatory 0 / 0 / 12 Late-stage results from the probe development effort to identify activators of OPRM1 and OPRD1 heterodimer formation: luminescence-based cell-based dose response HTR5A counterscreen
651765 confirmatory 0 / 0 / 28 Late-stage results from the probe development effort to identify activators of OPRM1 and OPRD1 heterodimer formation: luminescence-based cell-based dose response HTR5A counterscreen, Set 2
More...

Gene RIF (22)

PMID Text
24903772 Results suggest that TPH1 218A/C and HTR5A 12A/T polymorphisms cannot predict treatment response in major depression
20734064 Observational study of gene-disease association. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20388841 Serotonin (5-HT) receptor 5A sequence variants affect human plasma triglyceride levels
20388841 Observational study of gene-disease association. (HuGE Navigator)
19455600 Observational study of gene-disease association. (HuGE Navigator)
19381154 Childhood anxiousness did not mediate the effects of HTR2A and HTR5A on mood disorders.
19381154 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19328558 Association of a SNP of HTR5A gene is a susceptibility factor to bipolar disease in Bulgarian population.
19328558 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLLVLATILRVRT      1 - 70
FHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIACDVLCCTASIWNVTAIALDRY     71 - 140
WSITRHMEYTLRTRKCVSNVMIALTWALSAVISLAPLLFGWGETYSEGSEECQVSREPSYAVFSTVGAFY    141 - 210
LPLCVVLFVYWKIYKAAKFRVGSRKTNSVSPISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKE    211 - 280
QRAALMVGILIGVFVLCWIPFFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFK    281 - 350
NFFSRQH                                                                   351 - 357
//

Text Mined References (40)

PMID Year Title
24903772 2014 Serotonin-related polymorphisms in TPH1 and HTR5A genes are not associated with escitalopram treatment response in Korean patients with major depression.
24662972 2014 Genome-wide interaction study of smoking and bladder cancer risk.
23903073 2013 Genome-wide association study of the five-factor model of personality in young Korean women.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20388841 2010 Serotonin (5-HT) receptor 5A sequence variants affect human plasma triglyceride levels.
19455600 2010 Association study of the serotoninergic system in migraine in the Spanish population.
19381154 2010 Differences and similarities in the serotonergic diathesis for suicide attempts and mood disorders: a 22-year longitudinal gene-environment study.
19328558 2009 Case-control association study of 65 candidate genes revealed a possible association of a SNP of HTR5A to be a factor susceptible to bipolar disease in Bulgarian population.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
More...