Property Summary

Ligand Count 101
NCBI Gene PubMed Count 39
PubMed Score 48.78
PubTator Score 58.38

Knowledge Summary

Patent (2,965)

Expression

Gene RIF (22)

AA Sequence

MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLLVLATILRVRT      1 - 70
FHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIACDVLCCTASIWNVTAIALDRY     71 - 140
WSITRHMEYTLRTRKCVSNVMIALTWALSAVISLAPLLFGWGETYSEGSEECQVSREPSYAVFSTVGAFY    141 - 210
LPLCVVLFVYWKIYKAAKFRVGSRKTNSVSPISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKE    211 - 280
QRAALMVGILIGVFVLCWIPFFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFK    281 - 350
NFFSRQH                                                                   351 - 357
//

Text Mined References (40)

PMID Year Title