Property Summary

NCBI Gene PubMed Count 51
PubMed Score 93.82
PubTator Score 61.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
MICROPHTHALMIA, ISOLATED 8 1 0.0 0.0
Stomach Neoplasms 300 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Microphthalmia 76 4.266 2.1
Disease Target Count
Autism 2

Expression

  Differential Expression (23)

Disease log2 FC p
acute myeloid leukemia -1.300 4.5e-02
adrenocortical carcinoma -1.564 2.1e-02
aldosterone-producing adenoma -1.677 1.2e-02
Astrocytoma, Pilocytic 3.100 1.1e-07
Breast cancer -3.900 4.5e-22
breast carcinoma -1.400 1.2e-03
cystic fibrosis 3.805 1.0e-07
ependymoma -1.100 1.6e-02
gastric carcinoma 2.300 7.7e-03
intraductal papillary-mucinous adenoma (... -2.100 3.5e-03
intraductal papillary-mucinous carcinoma... -2.500 1.2e-03
invasive ductal carcinoma -1.304 1.1e-02
malignant mesothelioma -8.500 3.2e-10
nasopharyngeal carcinoma -2.000 4.1e-07
oligodendroglioma -1.100 5.6e-03
osteosarcoma -2.518 4.1e-02
ovarian cancer -4.100 6.7e-10
pituitary cancer -3.500 5.4e-11
primary pancreatic ductal adenocarcinoma 1.018 1.1e-02
primary Sjogren syndrome -1.200 3.2e-02
psoriasis 1.600 2.2e-04
sonic hedgehog group medulloblastoma 2.800 1.4e-03
subependymal giant cell astrocytoma -1.623 4.9e-03

Gene RIF (37)

AA Sequence

MATANGAVENGQPDRKPPALPRPIRNLEVKFTKIFINNEWHESKSGKKFATCNPSTREQICEVEEGDKPD      1 - 70
VDKAVEAAQVAFQRGSPWRRLDALSRGRLLHQLADLVERDRATLAALETMDTGKPFLHAFFIDLEGCIRT     71 - 140
LRYFAGWADKIQGKTIPTDDNVVCFTRHEPIGVCGAITPWNFPLLMLVWKLAPALCCGNTMVLKPAEQTP    141 - 210
LTALYLGSLIKEAGFPPGVVNIVPGFGPTVGAAISSHPQINKIAFTGSTEVGKLVKEAASRSNLKRVTLE    211 - 280
LGGKNPCIVCADADLDLAVECAHQGVFFNQGQCCTAASRVFVEEQVYSEFVRRSVEYAKKRPVGDPFDVK    281 - 350
TEQGPQIDQKQFDKILELIESGKKEGAKLECGGSAMEDKGLFIKPTVFSEVTDNMRIAKEEIFGPVQPIL    351 - 420
KFKSIEEVIKRANSTDYGLTAAVFTKNLDKALKLASALESGTVWINCYNALYAQAPFGGFKMSGNGRELG    421 - 490
EYALAEYTEVKTVTIKLGDKNP                                                    491 - 512
//

Text Mined References (53)

PMID Year Title