Property Summary

NCBI Gene PubMed Count 42
PubMed Score 82.92
PubTator Score 61.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
psoriasis 6685 8.28942033707767E-71
Breast cancer 3099 4.46722114888537E-22
pituitary cancer 1972 5.36136104708625E-11
malignant mesothelioma 3163 3.23857941588984E-10
ovarian cancer 8492 6.73731300136618E-10
cystic fibrosis 1670 9.96781395940197E-8
pilocytic astrocytoma 3086 2.15229474202228E-7
nasopharyngeal carcinoma 1056 4.11309152424526E-7
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00115406506991621
breast carcinoma 1614 0.00122381772915915
sonic hedgehog group medulloblastoma 1482 0.00135871920115629
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00346671652752925
subependymal giant cell astrocytoma 2287 0.00490007959966642
oligodendroglioma 2849 0.00558948893935507
gastric carcinoma 832 0.00773840070007492
invasive ductal carcinoma 2950 0.010571716136203
primary pancreatic ductal adenocarcinoma 1271 0.011436352320431
aldosterone-producing adenoma 664 0.0119710022065044
ependymoma 2514 0.0160000972980393
adrenocortical carcinoma 1427 0.0211752432943127
primary Sjogren syndrome 789 0.0315112188868854
osteosarcoma 7933 0.0407861345313165
acute myeloid leukemia 785 0.0451911054244488
Disease Target Count Z-score Confidence
Microphthalmia 79 4.23 2.1
Disease Target Count Z-score Confidence
Cancer 2346 3.38 1.7
Ocular hypotension 7 3.196 1.6
Matthew-Wood syndrome 10 3.162 1.6
Disease Target Count
Autism 2
MICROPHTHALMIA, ISOLATED 8 1
Disease Target Count
Microphthalmia, isolated, 8 1

Expression

Synonym

Accession P47895 Q6NT64
Symbols ALDH6
MCOP8
RALDH3
ALDH1A6

Gene

PANTHER Protein Class (2)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid
S.cerevisiae OMA Inparanoid

Gene RIF (29)

PMID Text
26687806 the prevalence of ALDH1A3(+)/CD44(+) tumor cells in breast cancer is significantly associated with worse prognostic factors and favors a poor prognosis
26575197 ALDH1A3 was most relevant to extracellular matrix organization and cell adhesion biological process, and the ability of tumor invasion was suppressed after ALDH1A3 knockdown in vitro.
26352270 Whole-exome sequencing in a South American cohort links ALDH1A3, FOXN1 and RARB/retinoic acid regulation pathways to autism spectrum disorders.
25969992 ALDH1A3 is a target of miR-187 in human prostate cancer.
25868979 we demonstrated that a specific ALDH isoform, namely ALDH1A3, is enriched in chemoresistant mesothelioma cell subpopulations
25793304 the distribution of RALDH1, RALDH2, and RALDH3 in the postnatal eye was determined.
25684492 Increased hypermethylation of ALDH1A3 is associated with Glioblastoma.
25656374 Among unique genes up-regulated by Y15 in Lovo-1 and K1 resistant cells, a stem cell marker-ALDH1A3-was detected to be up-regulated >twofold.
25106087 ALDH1A3 induces differential RA signaling in breast cancer cells which affects the rate of breast cancer progression.
24907115 High ALDH1A3 expression is associated with non-small cell lung cancer.
More...

AA Sequence

MATANGAVENGQPDRKPPALPRPIRNLEVKFTKIFINNEWHESKSGKKFATCNPSTREQICEVEEGDKPD      1 - 70
VDKAVEAAQVAFQRGSPWRRLDALSRGRLLHQLADLVERDRATLAALETMDTGKPFLHAFFIDLEGCIRT     71 - 140
LRYFAGWADKIQGKTIPTDDNVVCFTRHEPIGVCGAITPWNFPLLMLVWKLAPALCCGNTMVLKPAEQTP    141 - 210
LTALYLGSLIKEAGFPPGVVNIVPGFGPTVGAAISSHPQINKIAFTGSTEVGKLVKEAASRSNLKRVTLE    211 - 280
LGGKNPCIVCADADLDLAVECAHQGVFFNQGQCCTAASRVFVEEQVYSEFVRRSVEYAKKRPVGDPFDVK    281 - 350
TEQGPQIDQKQFDKILELIESGKKEGAKLECGGSAMEDKGLFIKPTVFSEVTDNMRIAKEEIFGPVQPIL    351 - 420
KFKSIEEVIKRANSTDYGLTAAVFTKNLDKALKLASALESGTVWINCYNALYAQAPFGGFKMSGNGRELG    421 - 490
EYALAEYTEVKTVTIKLGDKNP                                                    491 - 512
//

Text Mined References (44)

PMID Year Title
26687806 2016 ALDH(+)/CD44(+) cells in breast cancer are associated with worse prognosis and poor clinical outcome.
26575197 2015 ALDH1A3: A Marker of Mesenchymal Phenotype in Gliomas Associated with Cell Invasion.
26352270 2015 Whole-Exome Sequencing in a South American Cohort Links ALDH1A3, FOXN1 and Retinoic Acid Regulation Pathways to Autism Spectrum Disorders.
25969992 2015 MiR-187 Targets the Androgen-Regulated Gene ALDH1A3 in Prostate Cancer.
25868979 2015 A STAT3-NFkB/DDIT3/CEBP? axis modulates ALDH1A3 expression in chemoresistant cell subpopulations.
25793304 2015 Identification of active retinaldehyde dehydrogenase isoforms in the postnatal human eye.
25684492 2015 Prognostic value of ALDH1A3 promoter methylation in gliob;astoma: a single center experience in Western China.
25656374 2015 Down-regulation of ALDH1A3, CD44 or MDR1 sensitizes resistant cancer cells to FAK autophosphorylation inhibitor Y15.
25106087 2015 Aldehyde dehydrogenase 1A3 influences breast cancer progression via differential retinoic acid signaling.
24907115 2014 Essential role of aldehyde dehydrogenase 1A3 for the maintenance of non-small cell lung cancer stem cells is associated with the STAT3 pathway.
More...