Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.33
PubTator Score 10.33

Knowledge Summary

Patent (5,603)

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Bipolar Disorder 666 0.0 0.9

Expression

AA Sequence

MSLQKLMEPEAGTNRTAVAEFILLGLVQTEEMQPVVFVLLLFAYLVTTGGNLSILAAVLVEPKLHAPMYF      1 - 70
FLGNLSVLDVGCITVTVPAMLGRLLSHKSTISYDACLSQLFFFHLLAGMDCFLLTAMAYDRLLAICQPLT     71 - 140
YSTRMSQTVQRMLVAASLACAFTNALTHTVAMSTLNFCGPNEVNHFYCDLPQLFQLSCSSTQLNELLLFA    141 - 210
VGFIMAGTPLVLIITAYSHVAAAVLRIRSVEGRKKAFSTCGSHLTVVCLFFGRGIFNYMRLGSEEASDKD    211 - 280
KGVGVFNTVINPMLNPLIYSLRNPDVQGALWQIFLGRRSLT                                 281 - 321
//

Text Mined References (9)

PMID Year Title