Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.33
PubTator Score 10.33

Knowledge Summary

Patent (5,603)



Accession P47893 Q6IFM3 Q9P1Q3
Symbols OR228


  Ortholog (1)

Species Source
Chimp OMA EggNOG Inparanoid

AA Sequence

KGVGVFNTVINPMLNPLIYSLRNPDVQGALWQIFLGRRSLT                                 281 - 321

Text Mined References (9)

PMID Year Title
23958962 2014 Genome-wide association study of cocaine dependence and related traits: FAM53B identified as a risk gene.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10673334 2000 Sequence, structure, and evolution of a complete human olfactory receptor gene cluster.
9500546 1998 Distribution of olfactory receptor genes in the human genome.
8921386 1996 Sequence analysis in the olfactory receptor gene cluster on human chromosome 17: recombinatorial events affecting receptor diversity.
8004088 1994 Olfactory receptor gene cluster on human chromosome 17: possible duplication of an ancestral receptor repertoire.