Property Summary

NCBI Gene PubMed Count 10
PubMed Score 5.44
PubTator Score 8.40

Knowledge Summary

Patent (5,577)

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 3.4e-10
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Endometriosis 540 0.0 1.7

Gene RIF (3)

AA Sequence

MEGKNLTSISECFLLGFSEQLEEQKPLFGSFLFMYLVTVAGNLLIILVIITDTQLHTPMYFFLANLSLAD      1 - 70
ACFVSTTVPKMLANIQIQSQAISYSGCLLQLYFFMLFVMLEAFLLAVMAYDCYVAICHPLHYILIMSPGL     71 - 140
CIFLVSASWIMNALHSLLHTLLMNSLSFCANHEIPHFFCDINPLLSLSCTDPFTNELVIFITGGLTGLIC    141 - 210
VLCLIISYTNVFSTILKIPSAQGKRKAFSTCSSHLSVVSLFFGTSFCVDFSSPSTHSAQKDTVASVMYTV    211 - 280
VTPMLNPFIYSLRNQEIKSSLRKLIWVRKIHSP                                         281 - 313
//

Text Mined References (10)

PMID Year Title