Property Summary

NCBI Gene PubMed Count 10
PubMed Score 5.44
PubTator Score 8.40

Knowledge Summary

Patent (5,577)

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Endometriosis 535 1.0
ovarian cancer 8,484

Gene RIF (3)

PMID Text
22926438 Or1g1 is examined within a model for recognition of broadly tuned olfactory receptors.
18603653 OR1G1 recognizes a group of odorants that share both 3D structural and perceptual qualities.
12379593 OR17-209 fails to bind to the pig odorant-binding protein, while OR17-201 exhibits specific saturable binding

AA Sequence

MEGKNLTSISECFLLGFSEQLEEQKPLFGSFLFMYLVTVAGNLLIILVIITDTQLHTPMYFFLANLSLAD      1 - 70
ACFVSTTVPKMLANIQIQSQAISYSGCLLQLYFFMLFVMLEAFLLAVMAYDCYVAICHPLHYILIMSPGL     71 - 140
CIFLVSASWIMNALHSLLHTLLMNSLSFCANHEIPHFFCDINPLLSLSCTDPFTNELVIFITGGLTGLIC    141 - 210
VLCLIISYTNVFSTILKIPSAQGKRKAFSTCSSHLSVVSLFFGTSFCVDFSSPSTHSAQKDTVASVMYTV    211 - 280
VTPMLNPFIYSLRNQEIKSSLRKLIWVRKIHSP                                         281 - 313
//

Text Mined References (10)

PMID Year Title
23472165 2013 Genome-wide association study link novel loci to endometriosis.
22926438 2012 How broadly tuned olfactory receptors equally recognize their agonists. Human OR1G1 as a test case.
18603653 2008 Relationships between molecular structure and perceived odor quality of ligands for a human olfactory receptor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12379593 2002 Porcine odorant-binding protein selectively binds to a human olfactory receptor.
10673334 2000 Sequence, structure, and evolution of a complete human olfactory receptor gene cluster.
9500546 1998 Distribution of olfactory receptor genes in the human genome.
8004088 1994 Olfactory receptor gene cluster on human chromosome 17: possible duplication of an ancestral receptor repertoire.