Property Summary

NCBI Gene PubMed Count 10
PubMed Score 5.44
PubTator Score 8.40

Knowledge Summary

Patent (5,577)


  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 3.37651110734994E-10
Disease Target Count Z-score Confidence
Endometriosis 535 0.0 1.0


Accession P47890 Q4VBM1 Q6IFL9 Q9UM76
Symbols OR1G2


  Ortholog (2)

Species Source
Chimp OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid

Gene RIF (3)

22926438 Or1g1 is examined within a model for recognition of broadly tuned olfactory receptors.
18603653 OR1G1 recognizes a group of odorants that share both 3D structural and perceptual qualities.
12379593 OR17-209 fails to bind to the pig odorant-binding protein, while OR17-201 exhibits specific saturable binding

AA Sequence

VTPMLNPFIYSLRNQEIKSSLRKLIWVRKIHSP                                         281 - 313

Text Mined References (10)

PMID Year Title
23472165 2013 Genome-wide association study link novel loci to endometriosis.
22926438 2012 How broadly tuned olfactory receptors equally recognize their agonists. Human OR1G1 as a test case.
18603653 2008 Relationships between molecular structure and perceived odor quality of ligands for a human olfactory receptor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12379593 2002 Porcine odorant-binding protein selectively binds to a human olfactory receptor.
10673334 2000 Sequence, structure, and evolution of a complete human olfactory receptor gene cluster.
9500546 1998 Distribution of olfactory receptor genes in the human genome.
8004088 1994 Olfactory receptor gene cluster on human chromosome 17: possible duplication of an ancestral receptor repertoire.