Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00
PubTator Score 2.00

Knowledge Summary

Patent (5,719)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
diabetes mellitus 1,663

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSLQKLMEPEAGTNRTAVAEFILLGLVQTEEMQPVVFVLLLFAYLVTTGGNLSILAAVLVEPKLHAPMYF      1 - 70
FLGNLSVLDVGCITVTVPAMLGRLLSHKSTISYDACLSQLFFFHLLAGMDCFLLTAMAYDRLLAICQPLT     71 - 140
YSTRMSQTVQRMLVAASWACAFTNALTHTVAMSTLNFCGPNEVNHFYCDLPQLFQLSCSSTQLNELLLFV    141 - 210
AAAFMAVAPLVFISVSYAHVVAAVLQIRSAEGRKKAFSTCGSHLTVVGIFYGTGVFSYMRLGSVESSDKD    211 - 280
KGVGVFMTVINPMLNPLIYSLRNTDVQGALCQLLVGKRSLT                                 281 - 321
//

Text Mined References (10)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12644552 2003 Population differences in the human functional olfactory repertoire.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
10673334 2000 Sequence, structure, and evolution of a complete human olfactory receptor gene cluster.
9500546 1998 Distribution of olfactory receptor genes in the human genome.
8004088 1994 Olfactory receptor gene cluster on human chromosome 17: possible duplication of an ancestral receptor repertoire.