Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00
PubTator Score 2.00

Knowledge Summary

Patent (5,719)

TINX Plot

  Disease (1)

Disease Target Count P-value
diabetes mellitus 1728 1.4e-02

Gene RIF (1)

AA Sequence

MSLQKLMEPEAGTNRTAVAEFILLGLVQTEEMQPVVFVLLLFAYLVTTGGNLSILAAVLVEPKLHAPMYF      1 - 70
FLGNLSVLDVGCITVTVPAMLGRLLSHKSTISYDACLSQLFFFHLLAGMDCFLLTAMAYDRLLAICQPLT     71 - 140
YSTRMSQTVQRMLVAASWACAFTNALTHTVAMSTLNFCGPNEVNHFYCDLPQLFQLSCSSTQLNELLLFV    141 - 210
AAAFMAVAPLVFISVSYAHVVAAVLQIRSAEGRKKAFSTCGSHLTVVGIFYGTGVFSYMRLGSVESSDKD    211 - 280
KGVGVFMTVINPMLNPLIYSLRNTDVQGALCQLLVGKRSLT                                 281 - 321
//

Text Mined References (10)

PMID Year Title