Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent (407)

Synonym

Accession P47887 O43877 O95632 Q0VAD5 Q0VAD6 Q9UL13
Symbols OR1E4
OR1E7
OST529
OR17-93
OR17-135
OR17-136

Gene

AA Sequence

MMGQNQTSISDFLLLGLPIQPEQQNLCYALFLAMYLTTLLGNLLIIVLIRLDSHLHTPVYLFLSNLSFSD      1 - 70
LCFSSVTMPKLLQNMQNQDPSIPYADCLTQMYFFLYFSDLESFLLVAMAYDRYVAICFPMHYTAICFLLH     71 - 140
YTAIMSPMLCLSVVALSWVLTTFHAMLHTLLMARLCFCADNVIPHFFCDMSALLKLACSDTRVNEWVIFI    141 - 210
MGGLILVIPFLLILGSYARIVSSILKVPSSKGICKAFSTCGSHLSVVSLFYGTVIGLYLCPSANSSTLKD    211 - 280
TVMAMMYTVVTPMLTPFIYSLRNRDMKGALERVICKRKNPFLL                               281 - 323
//

Text Mined References (9)

PMID Year Title
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
10673334 2000 Sequence, structure, and evolution of a complete human olfactory receptor gene cluster.
9500546 1998 Distribution of olfactory receptor genes in the human genome.
8004088 1994 Olfactory receptor gene cluster on human chromosome 17: possible duplication of an ancestral receptor repertoire.
804088 1975 Development of polysaccharide vaccines for the prevention of meningococcal diseases.