Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent (407)

AA Sequence

MMGQNQTSISDFLLLGLPIQPEQQNLCYALFLAMYLTTLLGNLLIIVLIRLDSHLHTPVYLFLSNLSFSD      1 - 70
LCFSSVTMPKLLQNMQNQDPSIPYADCLTQMYFFLYFSDLESFLLVAMAYDRYVAICFPMHYTAICFLLH     71 - 140
YTAIMSPMLCLSVVALSWVLTTFHAMLHTLLMARLCFCADNVIPHFFCDMSALLKLACSDTRVNEWVIFI    141 - 210
MGGLILVIPFLLILGSYARIVSSILKVPSSKGICKAFSTCGSHLSVVSLFYGTVIGLYLCPSANSSTLKD    211 - 280
TVMAMMYTVVTPMLTPFIYSLRNRDMKGALERVICKRKNPFLL                               281 - 323
//

Text Mined References (9)

PMID Year Title