Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.40

Knowledge Summary

Patent

No data available

AA Sequence

MDGDNQSENSQFLLLGISESPEQQQILFWMFLSMYLVTVLGNVLIILAISSDSHLHTPMYFFLANLSFTD      1 - 70
LFFVTNTIPKMLVNFQSQNKAISYAGCLTQLYFLVSLVTLDNLILAVMAYDRYVAICCPLHYVTAMSPGL     71 - 140
CVLLLSLCWGLSVLYGLLLTFLLTRVTFCGPREIHYLFCDMYILLWLACSNTHIIHTALIATGCFIFLTL    141 - 210
LGFMTTSYVRIVRTILQMPSASKKYKTFSTCASHLGVVSLFYGTLAMVYLQPLHTYSMKDSVATVMYAVL    211 - 280
TPMMNPFIYSLRNKDMHGAPGRVLWRPFQRP                                           281 - 311
//

Text Mined References (5)

PMID Year Title
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
10673334 2000 Sequence, structure, and evolution of a complete human olfactory receptor gene cluster.
8004088 1994 Olfactory receptor gene cluster on human chromosome 17: possible duplication of an ancestral receptor repertoire.