Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00
PubTator Score 0.25

Knowledge Summary

Patent

No data available

AA Sequence

MDLGNSGNDSVVTKFVLLGLTETAALQPILFVIFLLAYVTTIGGTLSILAAILMETKLHSPMYFFLGNLS      1 - 70
LPDVGCVSVTVPAMLSHFISNDRSIPYKACLSELFFFHLLAGADCFLLTIMAYDRYLAICQSLTYSSRMS     71 - 140
WGIQQALVGMSCVFSFTNALTQTVALSPLNFCGPNVINHFYCDLPQPFQLSCSSVHLNGQLLFVAAAFMG    141 - 210
VAPLVLITVSYAHVAAAVLRIRSAEGRKKAFSTCSSHLTVVGIFYGTGVFSYTRLGSVESSDKDKGIGIL    211 - 280
NTVISPMLNPLIYWTSLLDVGCISHCSSDAGVSPGPPVQSSLCCLQFTALLSPPPGWGGLSPLNSHGL      281 - 348
//

Text Mined References (9)

PMID Year Title
16939646 2006 A probabilistic classifier for olfactory receptor pseudogenes.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
10673334 2000 Sequence, structure, and evolution of a complete human olfactory receptor gene cluster.
8921386 1996 Sequence analysis in the olfactory receptor gene cluster on human chromosome 17: recombinatorial events affecting receptor diversity.
8004088 1994 Olfactory receptor gene cluster on human chromosome 17: possible duplication of an ancestral receptor repertoire.