Property Summary

NCBI Gene PubMed Count 10
PubMed Score 12.38
PubTator Score 97.82

Knowledge Summary

Patent (430)

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1728 1.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.500 1.4e-03

Gene RIF (2)

AA Sequence

MQPESGANGTVIAEFILLGLLEAPGLQPVVFVLFLFAYLVTVRGNLSILAAVLVEPKLHTPMYFFLGNLS      1 - 70
VLDVGCISVTVPSMLSRLLSRKRAVPCGACLTQLFFFHLFVGVDCFLLTAMAYDRFLAICRPLTYSTRMS     71 - 140
QTVQRMLVAASWACAFTNALTHTVAMSTLNFCGPNVINHFYCDLPQLFQLSCSSTQLNELLLFAVGFIMA    141 - 210
GTPMALIVISYIHVAAAVLRIRSVEGRKKAFSTCGSHLTVVAIFYGSGIFNYMRLGSTKLSDKDKAVGIF    211 - 280
NTVINPMLNPIIYSFRNPDVQSAIWRMLTGRRSLA                                       281 - 315
//

Text Mined References (11)

PMID Year Title