Property Summary

NCBI Gene PubMed Count 11
Grant Count 48
R01 Count 39
Funding $7,238,002.63
PubMed Score 249.56
PubTator Score 207.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Olfactory neuroblastoma 5 4.28 2.1

Expression

Gene RIF (2)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAEDRPQQPQLDMPLVLDQGLTRQMRLRVESLKQRGEKRQDGEKLLQPAESVYRLNFTQQQRLQFERWNV      1 - 70
VLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPTAIFWRKEDSDAIDWNEADALEFGERLSDLAKIRKVMY     71 - 140
FLVTFGEGVEPANLKASVVFNQL                                                   141 - 163
//

Text Mined References (11)

PMID Year Title
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12911636 2003 Identification of members of the Bex gene family as olfactory marker protein (OMP) binding partners.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12054873 2002 Olfactory marker protein (OMP) exhibits a beta-clam fold in solution: implications for target peptide interaction and olfactory signal transduction.
8790421 1996 Olfactory marker protein (OMP) gene deletion causes altered physiological activity of olfactory sensory neurons.
8754248 1996 Molecular genetics of mammalian olfaction.
8499899 1993 Human olfactory marker protein maps close to tyrosinase and is a candidate gene for Usher syndrome type I.
More...