Property Summary

Ligand Count 1
NCBI Gene PubMed Count 44
PubMed Score 34.83
PubTator Score 90.78

Knowledge Summary

Patent (10,177)

Expression

 GO Function (1)

Gene RIF (21)

AA Sequence

MRPHLSPPLQQLLLPVLLACAAHSTGALPRLCDVLQVLWEEQDQCLQELSREQTGDLGTEQPVPGCEGMW      1 - 70
DNISCWPSSVPGRMVEVECPRFLRMLTSRNGSLFRNCTQDGWSETFPRPNLACGVNVNDSSNEKRHSYLL     71 - 140
KLKVMYTVGYSSSLVMLLVALGILCAFRRLHCTRNYIHMHLFVSFILRALSNFIKDAVLFSSDDVTYCDA    141 - 210
HRAGCKLVMVLFQYCIMANYSWLLVEGLYLHTLLAISFFSERKYLQGFVAFGWGSPAIFVALWAIARHFL    211 - 280
EDVGCWDINANASIWWIIRGPVILSILINFILFINILRILMRKLRTQETRGNEVSHYKRLARSTLLLIPL    281 - 350
FGIHYIVFAFSPEDAMEIQLFFELALGSFQGLVVAVLYCFLNGEVQLEVQKKWQQWHLREFPLHPVASFS    351 - 420
NSTKASHLEQSQGTCRTSII                                                      421 - 440
//

Text Mined References (45)

PMID Year Title