Property Summary

NCBI Gene PubMed Count 42
Grant Count 95
R01 Count 22
Funding $50,657,625.77
PubMed Score 32.88
PubTator Score 90.78

Knowledge Summary

Patent (10,177)

Expression

Synonym

Accession P47872 Q12961 Q13213 Q53T00 SCT-R
Symbols SR

Gene

  TechDev Info (1)

 GO Function (1)

Gene RIF (19)

PMID Text
26740626 Cysteine trapping identified charge-charge interactions between secretin and secretin receptor residues in TM5, TM6, ECL2, and ECL3 domains.
26397240 Our findings indicate that SCTR suppresses the proliferation of normal breast cells, while the gene stimulates the proliferation and migration of cancer cells being downregulated by promoter methylation.
25241033 High SCTR expression is associated with liver metastases of pancreas neuroendocrine tumors.
23168245 Taken together, we propose here that the down-regulatory effects of NRSF on hSCTR gene expression are mediated via its suppression on Sp1-mediated transactivation.
22964305 Data suggest that the interaction between secretin peptide residue H1 and secretin receptor residue W274 is most compatible with a hydrophobic interaction.
22565418 Results suggest that Secretin is a potent modulator of adipocyte functions, demonstrating overall a role in enhanced substrate cycling.
21851058 binding and activity of a series of 11 truncated and lactam-constrained secretin(5-27) analogues at the prototypic member of this family, the secretin receptor
19904746 results demonstrate that secretin and/or the modulation of SCTR expression might have potential as a therapeutic tool in the treatment of cholangiocarcinoma
19886671 Increasing expression of secretin receptor competes for receptor modifying protein 3 (RAMP3) association with calcitonin receptor-like receptor (CLR) to yield a functional adrenomedullin receptor.
18680717 These results suggest that the secretin receptor can exist only as a structurally-specific homo-dimer, without being present as higher-order oligomers.
More...

AA Sequence

MRPHLSPPLQQLLLPVLLACAAHSTGALPRLCDVLQVLWEEQDQCLQELSREQTGDLGTEQPVPGCEGMW      1 - 70
DNISCWPSSVPGRMVEVECPRFLRMLTSRNGSLFRNCTQDGWSETFPRPNLACGVNVNDSSNEKRHSYLL     71 - 140
KLKVMYTVGYSSSLVMLLVALGILCAFRRLHCTRNYIHMHLFVSFILRALSNFIKDAVLFSSDDVTYCDA    141 - 210
HRAGCKLVMVLFQYCIMANYSWLLVEGLYLHTLLAISFFSERKYLQGFVAFGWGSPAIFVALWAIARHFL    211 - 280
EDVGCWDINANASIWWIIRGPVILSILINFILFINILRILMRKLRTQETRGNEVSHYKRLARSTLLLIPL    281 - 350
FGIHYIVFAFSPEDAMEIQLFFELALGSFQGLVVAVLYCFLNGEVQLEVQKKWQQWHLREFPLHPVASFS    351 - 420
NSTKASHLEQSQGTCRTSII                                                      421 - 440
//

Text Mined References (43)

PMID Year Title
26740626 2016 Use of Cysteine Trapping to Map Spatial Approximations between Residues Contributing to the Helix N-capping Motif of Secretin and Distinct Residues within Each of the Extracellular Loops of Its Receptor.
26397240 2015 SCTR regulates cell cycle-related genes toward anti-proliferation in normal breast cells while having pro-proliferation activity in breast cancer cells.
25241033 2014 Gene expression accurately distinguishes liver metastases of small bowel and pancreas neuroendocrine tumors.
23264731 2013 MTR120/KIAA1383, a novel microtubule-associated protein, promotes microtubule stability and ensures cytokinesis.
23168245 2013 Neuron-restrictive silencer factor functions to suppress Sp1-mediated transactivation of human secretin receptor gene.
22964305 2012 Mapping spatial approximations between the amino terminus of secretin and each of the extracellular loops of its receptor using cysteine trapping.
22565418 2013 Effect of secretin on preadipocyte, differentiating and mature adipocyte functions.
21851058 2011 Lactam constraints provide insights into the receptor-bound conformation of secretin and stabilize a receptor antagonist.
19904746 2010 Secretin inhibits cholangiocarcinoma growth via dysregulation of the cAMP-dependent signaling mechanisms of secretin receptor.
19886671 2009 Molecular basis of association of receptor activity-modifying protein 3 with the family B G protein-coupled secretin receptor.
More...