Property Summary

Ligand Count 65
NCBI Gene PubMed Count 84
PubMed Score 30.44
PubTator Score 39.12

Knowledge Summary

Patent (3,978)

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Schizophrenia 1160 4.722 2.4
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.5
Liver cancer 604 0.0 0.5

Expression

  Differential Expression (15)

Disease log2 FC p
adrenocortical carcinoma -1.024 2.5e-04
adult high grade glioma -4.900 2.7e-07
astrocytic glioma -3.300 1.2e-03
Astrocytoma, Pilocytic -4.400 1.3e-09
atypical teratoid / rhabdoid tumor -6.000 7.5e-19
chronic lymphosyte leukemia 1.300 2.1e-02
ependymoma -4.200 4.8e-04
glioblastoma -4.600 5.0e-10
group 3 medulloblastoma -3.300 1.2e-03
intraductal papillary-mucinous neoplasm ... 1.700 2.9e-03
medulloblastoma, large-cell -4.500 9.2e-07
oligodendroglioma -2.900 2.0e-02
osteosarcoma 1.259 6.9e-07
ovarian cancer -2.300 4.3e-08
primitive neuroectodermal tumor -4.300 3.8e-04

Protein-protein Interaction (2)

Gene RIF (68)

AA Sequence

MWRVRKRGYFGIWSFPLIIAAVCAQSVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPVAVGMNIDIAS      1 - 70
IDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMI     71 - 140
RLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTKIELPQF    141 - 210
SIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGIT    211 - 280
TVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYALVNYIFFGRGPQRQKKAAEKAASANN    281 - 350
EKMRLDVNKIFYKDIKQNGTQYRSLWDPTGNLSPTRRTTNYDFSLYTMDPHENILLSTLEIKNEMATSEA    351 - 420
VMGLGDPRSTMLAYDASSIQYRKAGLPRHSFGRNALERHVAQKKSRLRRRASQLKITIPDLTDVNAIDRW    421 - 490
SRIFFPVVFSFFNIVYWLYYVN                                                    491 - 512
//

Text Mined References (85)

PMID Year Title