Property Summary

Ligand Count 136
NCBI Gene PubMed Count 97
PubMed Score 88.48
PubTator Score 112.39

Knowledge Summary

Patent (1,605)


  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.5
Disease Target Count
Alcohol dependence 107


  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -2.100 2.4e-03
astrocytic glioma -2.700 4.4e-03
Astrocytoma, Pilocytic -2.400 8.6e-06
atypical teratoid / rhabdoid tumor -2.500 1.1e-05
ependymoma -2.600 1.1e-02
glioblastoma -2.200 1.5e-07
group 3 medulloblastoma -1.900 2.4e-02
lung carcinoma 1.500 1.2e-12
medulloblastoma, large-cell -2.600 3.5e-04
oligodendroglioma -2.500 6.9e-03
Parkinson's disease -1.500 2.2e-02
pituitary cancer -1.100 3.1e-04
primitive neuroectodermal tumor -2.700 2.7e-04
psoriasis -1.500 9.8e-25
subependymal giant cell astrocytoma -3.798 8.8e-03
ulcerative colitis -1.100 2.7e-02

 CSPA Cell Line (2)

Protein-protein Interaction (1)

Gene RIF (106)

AA Sequence

SRIVFPVLFGTFNLVYWATYLNREPVLGVSP                                           421 - 451

Text Mined References (98)

PMID Year Title