Property Summary

NCBI Gene PubMed Count 27
Grant Count 23
R01 Count 17
Funding $2,017,536.63
PubMed Score 17.22
PubTator Score 20.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -3.000 0.000
osteosarcoma 1.912 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
intraductal papillary-mucinous neoplasm ... 1.900 0.038
lung cancer 1.200 0.001
sarcoidosis 1.300 0.013
Breast cancer 2.400 0.031
ovarian cancer -1.500 0.000

Gene RIF (10)

PMID Text
26769193 The finding of this study suggested that an SF3B1 or EIF1AX mutation is present in a substantial subset of primary LMNs underscores that these tumors genetically resemble uveal melanoma and are different from cutaneous melanoma at the genetic level.
24970262 The effect of an EIF1AX mutation is estimated to be a decreased odds of metastasis in uveal melanoma.
24874742 Then, activated p38 further enhanced the docking of activating transcription factor 4 (ATF4) onto the CHOP (CCAAT/enhancer-binding protein homologous protein) promoter via eIF2alpha to enhance apoptosis
23793026 the newly identified driver mutations in EIF1AX and SF3B1, specifically found in uveal melanomas with disomy 3, confirm and extend the established classification model of uveal melanoma.
23293029 Coordinated movements of eukaryotic translation initiation factors eIF1, eIF1A, and eIF5 trigger phosphate release from eIF2 in response to start codon recognition by the ribosomal preinitiation complex
20060839 eIF3j/HCR1 closely cooperates with the eIF3b/PRT1 RNA recognition motif and eIF1A on the ribosome to ensure proper formation of the scanning-arrested conformation required for stringent AUG recognition
17784828 The efficiency of the EF-1alpha promoter was higher than that of the cytomegalovirus promoter in all embryonic stem cells trnasfected.
12569173 determination of binding site on eukaryotic initiation factor 5B
12426392 Exp5 exports eEF1A via tRNA from nuclei and synergizes with other transport pathways to confine translation to the cytoplasm.
11699879 Remarkable conservation of translation initiation factors: IF1/eIF1A and IF2/eIF5B are universally distributed phylogenetic markers.

AA Sequence

MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVW      1 - 70
INTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDED     71 - 140
IDDI                                                                      141 - 144
//

Text Mined References (29)

PMID Year Title
26769193 2016 SF3B1 and EIF1AX mutations occur in primary leptomeningeal melanocytic neoplasms; yet another similarity to uveal melanomas.
24970262 2014 Chromosome 3 status combined with BAP1 and EIF1AX mutation profiles are associated with metastasis in uveal melanoma.
24874742 2014 Involvement of p38 in signal switching from autophagy to apoptosis via the PERK/eIF2?/ATF4 axis in selenite-treated NB4 cells.
23793026 2013 Exome sequencing identifies recurrent somatic mutations in EIF1AX and SF3B1 in uveal melanoma with disomy 3.
23435562 2013 Structural basis for the nuclear export activity of Importin13.
23293029 2013 Coordinated movements of eukaryotic translation initiation factors eIF1, eIF1A, and eIF5 trigger phosphate release from eIF2 in response to start codon recognition by the ribosomal preinitiation complex.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
21139563 2011 Structure of Importin13-Ubc9 complex: nuclear import and release of a key regulator of sumoylation.
More...