Property Summary

NCBI Gene PubMed Count 36
PubMed Score 22.87
PubTator Score 20.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.400 7.7e-05
Breast cancer 2.400 3.1e-02
intraductal papillary-mucinous neoplasm ... 1.900 3.8e-02
lung cancer 1.200 1.4e-03
osteosarcoma 1.912 2.2e-04
ovarian cancer -1.500 2.6e-04
psoriasis -3.000 6.7e-05
sarcoidosis 1.300 1.3e-02

Gene RIF (18)

AA Sequence

MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVW      1 - 70
INTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDED     71 - 140
IDDI                                                                      141 - 144
//

Text Mined References (38)

PMID Year Title