Property Summary

NCBI Gene PubMed Count 26
PubMed Score 26.31
PubTator Score 54.88

Knowledge Summary

Patent (6,884)

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Retinitis Pigmentosa 226 4.001 2.0
Retinitis pigmentosa 44 2 0.0 0.0
Disease Target Count Z-score Confidence
Fundus dystrophy 83 3.424 1.7
Cone dystrophy 71 3.065 1.5

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.500 2.9e-03
Astrocytoma, Pilocytic -1.500 3.9e-05
atypical teratoid / rhabdoid tumor -1.700 1.1e-04
ependymoma -1.500 8.5e-11
glioblastoma -1.300 3.4e-05
group 4 medulloblastoma -1.700 1.2e-03
medulloblastoma, large-cell -1.500 5.9e-03
osteosarcoma 1.205 1.8e-06
Pick disease 1.200 2.5e-02
primitive neuroectodermal tumor -1.700 2.9e-03
psoriasis -1.600 1.2e-07

Gene RIF (11)

AA Sequence

MAETSALPTGFGELEVLAVGMVLLVEALSGLSLNTLTIFSFCKTPELRTPCHLLVLSLALADSGISLNAL      1 - 70
VAATSSLLRRWPYGSDGCQAHGFQGFVTALASICSSAAIAWGRYHHYCTRSQLAWNSAVSLVLFVWLSSA     71 - 140
FWAALPLLGWGHYDYEPLGTCCTLDYSKGDRNFTSFLFTMSFFNFAMPLFITITSYSLMEQKLGKSGHLQ    141 - 210
VNTTLPARTLLLGWGPYAILYLYAVIADVTSISPKLQMVPALIAKMVPTINAINYALGNEMVCRGIWQCL    211 - 280
SPQKREKDRTK                                                               281 - 291
//

Text Mined References (26)

PMID Year Title