Property Summary

NCBI Gene PubMed Count 8
Grant Count 3
Funding $53,062.01
PubMed Score 11.91
PubTator Score 8.24

Knowledge Summary

Patent (6,215)

Expression

  Differential Expression (6)

Disease log2 FC p
ependymoma -1.400 0.000
diabetes mellitus 1.200 0.002
atypical teratoid/rhabdoid tumor -1.200 0.000
group 4 medulloblastoma 2.000 0.000
subependymal giant cell astrocytoma -1.471 0.036
psoriasis -2.200 0.000

Synonym

Accession P47775 Q5T8P3
Symbols GPCR12
GPCR21
PPP1R84

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

Gene RIF (2)

PMID Text
22430950 GPR12 may play a role in cell proliferation and survival
12649592 control of gene expression in vascular endothelial cells in the presence of fluid shear stress and classifies it as a sphingosine 1-phosphate receptor

AA Sequence

MNEDLKVNLSGLPRDYLDAAAAENISAAVSSRVPAVEPEPELVVNPWDIVLCTSGTLISCENAIVVLIIF      1 - 70
HNPSLRAPMFLLIGSLALADLLAGIGLITNFVFAYLLQSEATKLVTIGLIVASFSASVCSLLAITVDRYL     71 - 140
SLYYALTYHSERTVTFTYVMLVMLWGTSICLGLLPVMGWNCLRDESTCSVVRPLTKNNAAILSVSFLFMF    141 - 210
ALMLQLYIQICKIVMRHAHQIALQHHFLATSHYVTTRKGVSTLAIILGTFAACWMPFTLYSLIADYTYPS    211 - 280
IYTYATLLPATYNSIINPVIYAFRNQEIQKALCLICCGCIPSSLAQRARSPSDV                    281 - 334
//

Text Mined References (10)

PMID Year Title
22430950 2012 Involvement of GPR12 in the regulation of cell proliferation and survival.
19286662 2009 Lipid G protein-coupled receptor ligand identification using beta-arrestin PathHunter assay.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12649592 2003 Fluid shear stress differentially regulates gpr3, gpr6, and gpr12 expression in human umbilical vein endothelial cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12220620 2002 Sphingosine 1-phosphate is a ligand of the human gpr3, gpr6 and gpr12 family of constitutively active G protein-coupled receptors.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8530049 1995 Molecular cloning and chromosomal localization of human genes encoding three closely related G protein-coupled receptors.