Property Summary

NCBI Gene PubMed Count 9
PubMed Score 13.55
PubTator Score 8.24

Knowledge Summary

Patent (6,215)

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Thoracic aortic aneurysm 15 3.001 1.5

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid/rhabdoid tumor -1.200 1.0e-06
diabetes mellitus 1.200 2.2e-03
ependymoma -1.100 2.6e-02
group 4 medulloblastoma 2.000 2.6e-04
psoriasis -2.200 1.1e-56
subependymal giant cell astrocytoma -1.471 3.6e-02

Gene RIF (3)

AA Sequence

MNEDLKVNLSGLPRDYLDAAAAENISAAVSSRVPAVEPEPELVVNPWDIVLCTSGTLISCENAIVVLIIF      1 - 70
HNPSLRAPMFLLIGSLALADLLAGIGLITNFVFAYLLQSEATKLVTIGLIVASFSASVCSLLAITVDRYL     71 - 140
SLYYALTYHSERTVTFTYVMLVMLWGTSICLGLLPVMGWNCLRDESTCSVVRPLTKNNAAILSVSFLFMF    141 - 210
ALMLQLYIQICKIVMRHAHQIALQHHFLATSHYVTTRKGVSTLAIILGTFAACWMPFTLYSLIADYTYPS    211 - 280
IYTYATLLPATYNSIINPVIYAFRNQEIQKALCLICCGCIPSSLAQRARSPSDV                    281 - 334
//

Text Mined References (11)

PMID Year Title