Property Summary

NCBI Gene PubMed Count 30
Grant Count 53
R01 Count 17
Funding $11,265,192.39
PubMed Score 18.13
PubTator Score 24.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Rheumatoid Arthritis -1.200 0.003
psoriasis -2.200 0.000
astrocytoma 1.800 0.004
glioblastoma 1.300 0.006
tuberculosis 1.100 0.000
primary pancreatic ductal adenocarcinoma 1.222 0.017
non primary Sjogren syndrome sicca 1.200 0.020
spina bifida 1.119 0.039
ovarian cancer 2.900 0.000
pancreatic cancer 1.400 0.011
dermatomyositis -1.300 0.001

Gene RIF (3)

PMID Text
25496916 Actin filament capping protein subunit beta (CAPZB) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
21844192 RAGE has a role in endothelial cell membrane repair and regulates F-actin remodeling and membrane resealing
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDS      1 - 70
YRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDG     71 - 140
SKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHI    141 - 210
ANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIPDNQKFKQLQRELSQVLTQRQIYIQPDN       211 - 277
//

Text Mined References (40)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24852370 2014 Genome-wide association study identifies a novel susceptibility gene for serum TSH levels in Chinese populations.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23408906 2013 A meta-analysis of thyroid-related traits reveals novel loci and gender-specific differences in the regulation of thyroid function.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22494929 2012 Meta-analysis of two genome-wide association studies identifies four genetic loci associated with thyroid function.
More...