Property Summary

NCBI Gene PubMed Count 30
PubMed Score 18.13
PubTator Score 24.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
tuberculosis 1563 6.07973997261374E-9
ovarian cancer 8492 1.75456535136371E-7
psoriasis 6685 1.71187084735773E-5
dermatomyositis 967 7.14988843571019E-4
Rheumatoid Arthritis 1171 0.00290587370048702
astrocytoma 1493 0.0037193686977831
glioblastoma 5572 0.0059832635578961
pancreatic cancer 2300 0.0111948935346862
primary pancreatic ductal adenocarcinoma 1271 0.0170490131361789
non primary Sjogren syndrome sicca 840 0.0201273783648688
spina bifida 1064 0.038674098942829
Disease Target Count Z-score Confidence
Thyroid gland disease 4 0.0 2.0
Disease Target Count Z-score Confidence
Posterior uveitis 2 3.095 1.5
Epithelioid sarcoma 5 3.002 1.5

Expression

  Differential Expression (11)

Disease log2 FC p
Rheumatoid Arthritis -1.200 0.003
psoriasis -2.200 0.000
astrocytoma 1.800 0.004
glioblastoma 1.300 0.006
tuberculosis 1.100 0.000
primary pancreatic ductal adenocarcinoma 1.222 0.017
non primary Sjogren syndrome sicca 1.200 0.020
spina bifida 1.119 0.039
ovarian cancer 2.900 0.000
pancreatic cancer 1.400 0.011
dermatomyositis -1.300 0.001

Synonym

Accession P47756 Q32Q68 Q5U0L4 Q8TB49 Q9NUC4
Symbols CAPB
CAPZ
CAPPB

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (3)

PMID Text
25496916 Actin filament capping protein subunit beta (CAPZB) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
21844192 RAGE has a role in endothelial cell membrane repair and regulates F-actin remodeling and membrane resealing
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDS      1 - 70
YRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDG     71 - 140
SKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHI    141 - 210
ANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIPDNQKFKQLQRELSQVLTQRQIYIQPDN       211 - 277
//

Text Mined References (40)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24852370 2014 Genome-wide association study identifies a novel susceptibility gene for serum TSH levels in Chinese populations.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23408906 2013 A meta-analysis of thyroid-related traits reveals novel loci and gender-specific differences in the regulation of thyroid function.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22494929 2012 Meta-analysis of two genome-wide association studies identifies four genetic loci associated with thyroid function.
More...