Property Summary

NCBI Gene PubMed Count 33
PubMed Score 20.21
PubTator Score 24.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytoma 1.300 7.1e-03
dermatomyositis -1.300 7.1e-04
glioblastoma 1.300 6.0e-03
non primary Sjogren syndrome sicca 1.200 2.0e-02
ovarian cancer -1.200 1.6e-05
pancreatic cancer 1.400 1.1e-02
primary pancreatic ductal adenocarcinoma 1.222 1.7e-02
psoriasis -2.200 1.7e-05
Rheumatoid arthritis -1.200 2.9e-03
spina bifida 1.119 3.9e-02
tuberculosis 1.100 6.1e-09

Protein-protein Interaction (3)

Gene RIF (5)

AA Sequence

MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDS      1 - 70
YRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDG     71 - 140
SKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHI    141 - 210
ANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIPDNQKFKQLQRELSQVLTQRQIYIQPDN       211 - 277
//

Text Mined References (43)

PMID Year Title